KEGG   Mus musculus (house mouse): 230752
Entry
230752            CDS       T01002                                 
Symbol
Eva1b, 2610027C15Rik, Fam176b
Name
(RefSeq) eva-1 homolog B (C. elegans)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM176
Other DBs
NCBI-GeneID: 230752
NCBI-ProteinID: NP_742157
MGI: 1922063
Ensembl: ENSMUSG00000050212
UniProt: Q8K2Y3
Position
4:126039502..126043668
AA seq 164 aa
MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISCAPRSRPR
TPAPRRDPRSSTLEPEDEDDEEDEDTMTRLGPDDTLQGQELSTEPDGPLSVNVFTSAEEL
ERAQRLEERERILREIWRTGQPDLLGSGTLGPGATATLGRMHYY
NT seq 495 nt   +upstreamnt  +downstreamnt
atggatgccccaagaagggacatggagctactcagcaacagcctggcagcctatgcgcac
atcagagctaaccccgagagcttcggcctctacttcgtgcttggcgtctgcttcggcctg
ctgctgaccctatgcctgctggtcatcagcatctcctgcgcgcctcgctcgcgaccccgg
acccctgctccgcgccgggacccccggagcagcaccctagagccggaagacgaggacgat
gaggaagatgaggacaccatgacgaggctgggtcccgatgacacgctgcagggccaggag
ctgtccacagagcccgacgggccccttagtgtcaatgtcttcacgtcagcagaggagcta
gagcgggcacagcggctggaggagcgtgaacgaatcctgcgggagatctggcgcactggg
cagccagacctgctgggcagtggcacgctcgggcccggagccacggccacgctgggacga
atgcactattactga

DBGET integrated database retrieval system