KEGG   Mus musculus (mouse): 230752
Entry
230752            CDS       T01002                                 

Gene name
Eva1b, 2610027C15Rik, Fam176, Fam176b
Definition
(RefSeq) eva-1 homolog B (C. elegans)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: FAM176
Other DBs
NCBI-GeneID: 230752
NCBI-ProteinID: NP_742157
MGI: 1922063
Ensembl: ENSMUSG00000050212
Vega: OTTMUSG00000009357
UniProt: Q8K2Y3
Position
4; 4 D2.2
AA seq 164 aa
MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISCAPRSRPR
TPAPRRDPRSSTLEPEDEDDEEDEDTMTRLGPDDTLQGQELSTEPDGPLSVNVFTSAEEL
ERAQRLEERERILREIWRTGQPDLLGSGTLGPGATATLGRMHYY
NT seq 495 nt   +upstreamnt  +downstreamnt
atggatgccccaagaagggacatggagctactcagcaacagcctggcagcctatgcgcac
atcagagctaaccccgagagcttcggcctctacttcgtgcttggcgtctgcttcggcctg
ctgctgaccctatgcctgctggtcatcagcatctcctgcgcgcctcgctcgcgaccccgg
acccctgctccgcgccgggacccccggagcagcaccctagagccggaagacgaggacgat
gaggaagatgaggacaccatgacgaggctgggtcccgatgacacgctgcagggccaggag
ctgtccacagagcccgacgggccccttagtgtcaatgtcttcacgtcagcagaggagcta
gagcgggcacagcggctggaggagcgtgaacgaatcctgcgggagatctggcgcactggg
cagccagacctgctgggcagtggcacgctcgggcccggagccacggccacgctgggacga
atgcactattactga

DBGET integrated database retrieval system