KEGG   Mus musculus (house mouse): 230777
Entry
230777            CDS       T01002                                 
Symbol
Hcrtr1, Ox1r, ox-1-R, ox1-R
Name
(RefSeq) hypocretin (orexin) receptor 1
  KO
K04238  hypocretin (orexin) receptor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    230777 (Hcrtr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    230777 (Hcrtr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Orexin
    230777 (Hcrtr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7tm_4 Orexin_rec2
Other DBs
NCBI-GeneID: 230777
NCBI-ProteinID: NP_001156499
MGI: 2385650
Ensembl: ENSMUSG00000028778
Vega: OTTMUSG00000009509
UniProt: P58307
Position
4:complement(130024010..130033389)
AA seq 416 aa
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQA
AVMECSSVLPELANRTRLFSVCDEHWADELYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPGSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaaccctcggccactcctggggcccagcctggagtccccactagtagtggggaaccc
ttccatctgcctccagactatgaggacgagttcctccgatacctgtggcgcgattatctc
tacccgaagcagtacgagtgggttctcattgcagcctacgtggctgtgttcctcatagcc
ttggtgggcaataccctggtctgcctggctgtgtggcggaaccaccacatgaggacagtc
accaactacttcattgtcaacctgtccctggcagatgtgctggtgactgccatctgcctg
cctgccagcctgttagtggacatcaccgagtcgtggctcttcggccaggctttgtgcaag
gtcattccctatctccaggctgtgtcggtgtcagtggcagtgctgactctcagcttcatc
gccctggaccgctggtatgccatctgccacccactgttgttcaagagcacagctcgccgt
gcccgtggctccatcctgggcatctgggctgtgtcgctggctgtcatggtgccccaggct
gctgtcatggagtgcagcagcgtgctgcctgagctagccaatcgcacccggctcttctct
gtctgtgatgagcactgggcagatgaactctaccccaagatctatcacagctgctttttc
attgtcacctacctggccccactgggcctcatggctatggcctatttccagatcttccgc
aagctctggggccgccagatccctggtaccacatcagccttggtgcggaactggaaacgg
ccctcggaacaactggaggctcagcaccagggcctctgtacagagccccagccccgggcc
cgagccttcctggctgaggtgaagcagatgcgagctcggaggaagacggctaagatgctg
atggtagtcctgctggtttttgcactctgttatctgcccatcagtgtcctcaatgtcctt
aagagagtgttcgggatgttccgccaagccagcgaccgggaagccgtctacgcctgcttc
accttctcccactggctagtgtacgccaacagtgccgccaaccctatcatctacaacttc
ctcagtggcaaattccgggagcagttcaaggctgccttctcctgctgcctgcctggtctg
ggtcccggctcctctgccagacacaagtccttgtccttgcagagccgctgctccgtctcc
aaggtctctgagcatgtcgtgctgaccaccgtcactaccgtgctgtcctga

DBGET integrated database retrieval system