KEGG   Mus musculus (mouse): 230796
Entry
230796            CDS       T01002                                 

Gene name
Wdtc1, Gm695, a, ad, adipose, adp
Definition
(RefSeq) WD and tetratricopeptide repeats 1
  KO
K11807  WD and tetratricopeptide repeats protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    230796 (Wdtc1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     230796 (Wdtc1)
SSDB
Motif
Pfam: WD40 TPR_19 TPR_2 TPR_1 TPR_11 ANAPC4_WD40 TPR_14 TPR_6 ANAPC3 TPR_16
Other DBs
NCBI-GeneID: 230796
NCBI-ProteinID: NP_955010
MGI: 2685541
Ensembl: ENSMUSG00000037622
Vega: OTTMUSG00000011148
UniProt: Q80ZK9
Position
4; 4 D2.3
AA seq 677 aa
MAKVNITRDLIRRQVKERGALSFERRYHVTDPFIRRLGLEAELQGHSGCVNCLEWNEKGD
LLASGSDDQHTIVWDPLHHKKLLSMHTGHTANIFSVKFLPHAGDRILITGAADSKVHVHD
LTVKETIHMFGDHTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEY
CGPMVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMRQSPSAGVHTFCDRQK
PLPDGAAQYYVAGHLPVKLPDYNSRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTYK
QRPYTFLLPRKCHSVEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESKGCISPQVELPPY
LERVKQQANEAFACQQWTQAIQLYSQAVQKAPHNAMLYGNRAAAYMKRKWDGDHYDALRD
CLKAISLNPCHLKAHFRLARCLFELKYVAEALECLDDFKGKFPEQAHSSACDALGRDITA
ALFSKSDGEEKKAAGGGGGPVRLRSTSRKDSISEDEMVLRERSYDYQFRYCGHCNTTTDI
KEANFFGSNAQYIVSGSDDGSFFIWEKETTNLVRVLQGDESIVNCLQPHPSYCFLATSGI
DPVVRLWNPRPESEDLTGRVVEDMEGASQANQRRMNANPLEAMLLDMGYRITGLSSGGAG
ASDDEDSAEGQVQCRPS
NT seq 2034 nt   +upstreamnt  +downstreamnt
atggcaaaagtcaacataactagagacctcattcgtaggcaagtcaaggagcggggtgcc
ctgagctttgaacggcgatatcatgtcacagacccctttatccgacggctgggcctggag
gcggagcttcagggacactcaggctgtgtcaactgtctggagtggaatgagaaaggagac
ctgctggcgtctggttccgacgaccagcacaccattgtgtgggacccactgcaccacaag
aagctgctgtccatgcacacaggacacacagcaaatatcttctctgtcaagttcctgcct
catgctggagaccgcattttgatcacgggggcagctgactccaaggtgcacgtccacgac
cttacggtaaaggagacgatccacatgtttggagaccacacaaaccgggtgaagcgcatt
gccacggcgcccatgtggcctaacacgttctggagcgccgcagaggatgggcttatccgc
cagtatgaccttcgggagaacagcaaacactcagaggtgctgattgacctaacagaatac
tgtggcccgatggtggaggccaagtgcctcaccgtcaacccccaggataacaactgcctg
gcagtaggggccagtgggccctttgtgaggctctatgacattcgaatgatccacaaccac
agaaagagcatgaggcagagcccttccgcaggcgtgcataccttctgtgaccgacagaag
ccccttccggacggtgcagcgcagtattatgtcgcaggtcacctgccggtgaagctgcct
gactataacagccgtctgagagtgctggttgccacctatgtgaccttcagccccaatggc
acagagctgctagtcaacatgggaggagagcaggtgtatctgtttgacttgacttacaag
caacggccatataccttcctcttgcctagaaaatgccactccgtggaagtccagaacggc
aagatgtctactaacggggtgtccaacggcgtgtcgaatggcctacaccttcacagcaac
ggcttccggctgccagagagcaaggggtgcatcagcccccaggtggagctgcccccatac
ctggagcgtgtgaagcagcaggccaatgaagccttcgcctgccagcagtggacccaggcc
atccagctctacagccaggctgtgcagaaggccccgcacaacgctatgctctatggcaac
cgagctgccgcctacatgaagcgcaagtgggacggggaccactatgatgccctccgggac
tgcctcaaggccatctccctaaacccttgccacctgaaggcacacttccgtctggcccgg
tgcctctttgaactgaagtatgtggccgaggctctggagtgcctggatgacttcaaaggg
aagttcccagagcaggcccacagcagtgcatgtgacgcattaggccgggacatcacagct
gcccttttctccaaaagtgatggtgaggagaagaaggcagctggtggtggtggtggtcca
gttcgccttcgaagcacaagtcgcaaggactccatctcagaagacgaaatggtgctacgg
gaacggagctacgactatcagttccgctactgtgggcactgcaacaccaccacggatatc
aaggaggccaatttctttggcagcaatgctcagtacattgtcagcggctctgatgacggc
tccttcttcatctgggaaaaggagaccaccaacctcgtccgagtgctgcagggggatgag
tccattgtcaactgcttgcagccccatcccagctactgcttcctggccaccagtggcatc
gaccctgttgtgcgactgtggaacccacgaccagagagtgaagacctcacaggccgagtt
gtggaagatatggagggtgcatctcaggccaaccagcggcgcatgaatgccaaccccctg
gaggcgatgctgctggacatgggctatcggatcacaggcctgagcagcgggggcgccggg
gcctctgatgacgaggacagcgcagagggccaggtgcagtgccggcccagctag

DBGET integrated database retrieval system