KEGG   Mus musculus (mouse): 230824Help
Entry
230824            CDS       T01002                                 

Gene name
Grhl3, AI561912, Get1, Som, Tfcp2l4, ct
Definition
(RefSeq) grainyhead like transcription factor 3
  KO
K09275  transcription factor CP2 and related proteins
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Grainyhead
    230824 (Grhl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CP2
Motif
Other DBs
NCBI-GeneID: 230824
NCBI-ProteinID: NP_001013778
MGI: 2655333
Ensembl: ENSMUSG00000037188
Vega: OTTMUSG00000009727
UniProt: Q5FWH3
Position
4 D3; 4 67.76 cM
AA seq 603 aa AA seqDB search
MSNELDFRSVRLLKNDPVSFQKFPYSNEDEAWKTYLENPLTAATKAMMRVNGDEESVAAL
SFLYDYYMGPKEKRILSSSTGGRNDQGKKFYHSMDYEPDLAPLESPTHLMKFLTENVSGS
PDYTDQLKKNNLLGLEGVLPTPGKTNTVPPGPSKLEASSMDSYLLPASDIYDNGSLNSLF
ESIHGVPPTQRWQPDSTFKDDPQESLLFPDILKTSPDPPCPEDYPGLKSDFEYTLGSPKA
IHIKAGESPMAYLNKGQFYPVTLRTPAGGKGLALSSSKVKSVVMVVFDNDKVPVEQLRFW
RHWHSRQPTAKQRVIDVADCKENFNTVQHIEEVAYNALSFVWNVNEEAKVFIGVNCLSTD
FSSQKGVKGVPLNLQIDTYDCGAGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKV
KCPDSSNNAGIKGCLLSGFRGNETTYLRPETDLETQPVLFIPNLHFSSLQRPGGVVPSAG
HSSSDRLPLKRTCSPFAEEFEPLPSKQAKEDDLQRVLLYVRRETEEVFDALMLKTPDLKG
LRNAISEKYGLPEENICKVYKKCKRGILVNMDNNIIQHYSNHVAFLLDMGELDGKIQIIL
KEL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaacttgatttcaggtctgtgcggttgctgaagaatgaccctgtgagcttc
cagaagtttccctacagtaatgaggacgaggcctggaagacatacctggagaaccctttg
acggctgccaccaaagccatgatgagagtcaacggggacgaggagagtgtggctgctctg
agcttcctctacgactactatatgggtcccaaggagaagcggatactgtcctccagcact
ggtggccggaatgaccaaggaaagaagttctaccacagcatggactatgagccggatctt
gcccccctcgagagccccacacacctcatgaaatttttgacagagaacgtgtctggaagt
ccagactacacagaccagctcaagaaaaacaatctgctaggcttggagggggttctaccc
acccccggcaagaccaataccgtccccccaggtccgagtaaactggaagccagctccatg
gacagctacctcttgcccgccagtgacatatatgacaatggctccctcaactcattattt
gagagcattcatggggttccacccacacagcgctggcagccagacagcaccttcaaagat
gacccacaggagtctctgctcttccctgatattctgaagacatccccggaccccccatgc
ccagaggattatccaggcctcaagagtgactttgaatacaccctgggctcccccaaagcc
attcacatcaaagcaggggagtcacccatggcctacctcaacaagggtcagttctacccc
gtcaccctacgcaccccagcaggagggaaaggcctcgctctgtcctccagcaaagtcaag
agcgtggtgatggtcgtgttcgataatgacaaggtccccgtggagcagctgcgtttctgg
aggcactggcattcccggcagcccaccgccaagcagcgcgtcatcgacgtagctgactgt
aaggaaaacttcaacacggtccagcacattgaagaggtggcctataacgcgctgtccttt
gtgtggaatgtcaacgaggaagccaaggtgtttatcggtgtcaactgtctgagcacagac
ttctcctcgcagaagggagtgaagggtgtccccctgaacttgcaaattgacacctatgac
tgtggagcaggcactgagcgcctggtacaccgtgctgtctgccagatcaagatcttctgt
gataagggagctgagaggaagatgcgcgatgatgaacggaagcagtttcgaaggaaggtc
aagtgcccagactccagtaacaatgcaggaatcaagggctgcctgctgtcaggcttcagg
ggcaatgagaccacatacttgcggccagaaactgacctggagacccagcctgtgttgttt
atccccaatctgcatttttccagcctacagcgcccaggaggggttgtcccctcagcagga
cacagcagctctgacaggctgcctctgaagcgaacctgctcaccctttgctgaggagttt
gagcctcttccttctaaacaagccaaggaagatgaccttcagagagttctgttgtatgtg
aggagggagacagaggaggtgtttgacgcgctcatgttgaagaccccggacctgaagggc
ctgaggaatgcgatctctgagaagtacggcctccccgaggagaatatttgcaaagtctac
aagaaatgcaagcgaggcatcctggttaacatggacaacaacatcatccaacactacagc
aaccacgtggccttcctgctggacatgggtgagctggacggcaagatccagatcatcctg
aaggagctatga

DBGET integrated database retrieval system