KEGG   Mus musculus (mouse): 230848
Entry
230848            CDS       T01002                                 

Symbol
Zbtb40, BC059177, C230087D24, Gm571, mKIAA0478
Name
(RefSeq) zinc finger and BTB domain containing 40
  KO
K10512  zinc finger and BTB domain-containing protein 40
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    230848 (Zbtb40)
   04121 Ubiquitin system [BR:mmu04121]
    230848 (Zbtb40)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    230848 (Zbtb40)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     230848 (Zbtb40)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-met zf-Di19 XAF1_C zf-H2C2_5 zf-C2H2_11 zf-C2HC_2 zinc_ribbon_15 MCR_C zf-C2H2_6 DUF1635
Other DBs
NCBI-GeneID: 230848
NCBI-ProteinID: NP_937891
MGI: 2682254
Ensembl: ENSMUSG00000060862
Vega: OTTMUSG00000009824
UniProt: Q6PCS8
Position
4; 4 D3
AA seq 1258 aa
MELPSYSQQLLLQLYALCKEQRFCDCTISVGNIYFRAHKPVLAAASLLFKTLLDSTDAIS
IDASVVSPEEFALLLEMTYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTNLVNCS
VQGQVVRDVSVLSSEAGNKESEKPQVEALSSEGAEEPSSSPEVSAVPAGPEKAKTQDVIN
IATQEINADPPVAQEVQVAAEITGATPHTAEVCSPSPVGQIPSETKEVNTEAECETKQDQ
LTLLLEHESVFSDAALLTPDTLRRLAGCSEIEGPQKETIIECLTSEGGSSAFQRILDKVH
DGSLDVQVALSLVRLYQESTPAEKVSQIQPEGSAGEGKTLSVLLLEHKEDLIQCVTQLRP
IVEFLETAKEEFLPDSEKRVIQSCCEGRTPKEMIENLLHRVTEEKTLPAKSLVKLLQAVR
TAFPNLDLLLDNLQKGAGSAGTTGLARVSCESEWTDEPRPVCIPADRVDGSSPSPDAYGA
ELLRKYHENLSEILIDNQVLLKVISRMQSLAPGDREVMQTLVKQGSGSGGFSSLMLAALE
RQTLSATAIWQLLLAVEETETRPLNLLLEEVGKEPGAGAFFRAVTAPESTVLEAILRHSK
LLREAIQQTAGCERLSSEEEHLAETVQEMLSISSETVSPEASLRAVLSKAMEKSVSASVV
CHLLCSVHKSFPGLQPLMQELAHVGFLTKESGEERWKVTDGLHPGAKDKVEEVAKATGED
CQANEQKEQGEPGPVPEQPEKDTSASPDSAKKSFVCKACDKSFHFYCRLKVHMKRCRVAK
SRQVQSEEGSETKGSEKGLEKQQPDARGTGGEPDAPKKKKKRLPVTCDLCGREFAHASGM
QYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYH
TKKKHSEGKMYACQYCDAVFAQSIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHT
FHTDIEDPYDCKKCRMSFSTLQDHRKHIHEVHAKEYHPCPTCGKIFSAPSMLERHMVTHV
GGKPFSCGICNKAYQQLSGLWYHNRTHHPDVFAAQNHRSPKFSSLQCSSCDKTFSNTVEH
KKHIKTEHTDVKFHECDQCKELFPTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQH
HVTTEHFKQSESTFPCELCGELFTSQAQLDSHLESEHPKVAGTESQAAASRMVQVIRAPE
PAAPAEQVITLEETQLAGSQVFVTLPDSQTSQNSSELVAVTVEDLLDGTVTLICGEAK
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggaactccccagctacagccagcagctgcttctgcagctctacgccctgtgcaaggag
cagcggttctgtgattgcaccatttccgtcggcaacatctacttcagggcccacaagcca
gtcctggcagcagccagcctcctgttcaaaaccctgctggacagcacagacgccatctcc
atcgatgcatccgtggtgagccccgaagagtttgccctcttgctagaaatgacatacacc
ggtaagctacctgtgggcaagcacaacttctccaagatcatctccttagcagatagcctg
cagatgtttgacgtggccgttagttgtaaaaaccttctgaccaacctggtaaactgctct
gtccaggggcaggtggtaagagatgtctcagtgctgtcctcagaggcagggaacaaggag
tcagagaagccacaagtagaagccctctcctctgaaggtgctgaggagccctcttcttcc
ccggaagtttctgccgtgccagcgggccctgagaaagccaagacccaggacgtaatcaac
atagctacccaagagataaatgcagaccctcccgttgcccaagaggttcaggtggctgca
gagatcacaggggcgactcctcacacagctgaagtttgttccccttcccctgttggacaa
atcccaagtgagacgaaagaagtcaatacagaagcagagtgcgagacaaagcaggaccaa
ctgactctcctgctagagcatgaaagcgtcttctcagatgcagccttgctcaccccagac
accctgagaagactggcaggatgctcagagattgaagggcctcagaaggagaccataata
gaatgtctcacgagtgaaggaggcagttcagcgttccagagaattctggacaaagtgcac
gatgggagcctggatgtgcaggtggctctgtctctggtgagactataccaggagtctaca
cctgcagagaaagtgtctcagattcaaccagaagggagcgcaggagagggaaagaccttg
tctgttctgctactggaacacaaagaggacctgatccagtgtgtaacacagctcagacct
attgtggagttcctggaaacagccaaggaggaattcctgccagattccgaaaaaagggtg
attcagagctgctgtgagggcagaacacccaaggagatgatagagaatttgttgcacaga
gtgactgaagagaagaccctgcctgccaagagtctggtaaaactcctccaggctgtgagg
acagcattcccaaacctggacctcctgctggacaatttgcagaaaggagcgggatcagcc
ggcaccacaggcctggccagagtctcctgtgaatcagaatggacagatgagcccaggcca
gtgtgcattccagcagaccgcgtggatggatcctcccctagccctgatgcttacggagct
gagctgttgagaaagtaccatgagaacctgtctgagattctcatagacaaccaggtgctg
ctgaaggtgatctcacggatgcaaagcttagcccctggagacagagaggtcatgcagacc
ctcgtgaaacagggctctggctcgggtggcttcagttccctgatgttggcagctctggaa
aggcagactctctcagcaacggccatttggcaactactgctagcagttgaagagactgag
acccgcccactgaacctgctcttggaggaagtaggaaaggagcccggcgctggggctttc
ttccgggcagtgactgccccagagagcacagtattggaagccatcctgaggcacagcaag
ctgctccgggaagccatccagcagacagcggggtgtgagcgcctttcttcagaggaagaa
cacctggcagagaccgtgcaagagatgctgagcatatcctccgagacagtgagccctgaa
gcctccctgagagcggtgctgagcaaagccatggagaaatctgtctcggcctctgtggtc
tgtcacctcctctgcagtgtccacaagtctttccctggcctgcagcccctgatgcaggag
ttggcacatgttggtttccttaccaaggaaagcggagaggagaggtggaaggtgactgat
ggccttcaccctggagccaaggacaaagtggaggaagtggccaaggcaaccggagaagac
tgccaggccaatgaacaaaaggagcagggagagcctgggcccgtgccagagcaaccggag
aaagacacttctgcctccccagactctgccaagaagagcttcgtctgcaaagcctgtgat
aagagcttccatttctactgccgtctgaaggtgcacatgaagcgctgccgggtggccaag
agcaggcaggtgcagagcgaggagggcagcgagaccaagggctcggagaaggggctggag
aagcagcagccggacgcccgcggcacaggtggggagcccgatgcccccaagaagaagaag
aagcggctgccagtgacatgtgacctctgcggaagagagtttgcccatgcctcaggcatg
cagtaccacaagctgaccgagcacttcgacgagaaacctttctcctgtgaggaatgtggg
gcgaagtttgcagccaactctaccctgaagaaccacctgcgcctgcacaccggagaccgc
ccgttcatgtgcaagcattgcctcatgaccttcacgcaggcctccgccctggcttaccac
accaagaagaagcactcggaagggaaaatgtacgcgtgccagtactgtgacgccgtgttc
gcccagtcgatcgagctatcccggcatgtgaggacccacaccggggacaagccatatgtc
tgtagggactgtggaaagggcttccggcaagccaacggcctctccatccacctgcacacc
ttccacacagacatagaagacccttatgactgcaagaaatgcaggatgagcttctccaca
ctgcaggaccaccggaagcacatccacgaggtgcacgccaaggagtaccacccctgcccc
acgtgcggcaagatcttcagtgccccttccatgctggagcggcacatggtgacccacgtg
ggagggaagcccttcagctgtgggatctgcaacaaggcctaccagcaattgtctggattg
tggtaccacaatcggacgcaccacccagatgtgtttgctgctcagaaccatcggtcaccc
aagttctcatcactgcagtgtagctcctgtgacaagaccttttccaatactgtcgaacac
aagaagcacatcaaaacagaacacacagatgtgaagttccatgagtgtgaccagtgcaag
gagctcttccccacacctgctctgctccaggttcacgtcaagtgccagcattcagggtcg
cagccattccggtgcttgtactgtgcagccaccttccgcttcccgggagccctgcagcac
cacgtcaccacagagcactttaagcagtcggaaagcaccttcccctgcgagctctgtggc
gagctcttcacctcccaggcccagcttgatagccacttggagtctgagcacccaaaggtg
gcaggcactgagtcccaggcagctgcctctcgcatggtgcaggtgatccgagctccggag
ccagcggccccggccgagcaggtgatcacgttggaggagacgcagctcgctggctcgcag
gtgtttgtgaccttgccagattcacagacctctcagaacagctccgagcttgtggcagtg
acggtggaggatttgctggatggtactgtcacattgatctgtggtgaggccaagtga

DBGET integrated database retrieval system