KEGG   Mus musculus (mouse): 230868
Entry
230868            CDS       T01002                                 

Symbol
Igsf21, BC055811, Gm141
Name
(RefSeq) immunoglobulin superfamily, member 21
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set V-set ig C2-set_2
Other DBs
NCBI-GeneID: 230868
NCBI-ProteinID: NP_941012
MGI: 2681842
Ensembl: ENSMUSG00000040972
Vega: OTTMUSG00000010057
UniProt: Q7TNR6
Position
4:complement(139754163..139974294)
AA seq 468 aa
MQAAPSLRRASCLLLAAILDLARGYLTVNIEPLPPVVAGDAVTLKCNFKTDGRMREIVWY
RVTDGGTIKQKIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGI
YDRATREKVVLASGNIFLNVMAPPTSIEVVAADSPAPFSRYQAQNFTLVCIVSGGKPAPM
VYFKRDGEPIDAVPLTELPAASSGPVQDSRPFRSLLHRDVDDTKMQKSLSLLDTEYRAGR
PYTERPARSLTQDPSLFVQPTTENIPETVVSREFPRWVHSAEPVYFLRHSRTPGSDGTVE
VRALLTWTLNPQIDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIMMTPSRARVGDTVR
ILVHGFQNEVFPEPMFTWTRVGSRLLDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLG
STDTHTRLIVFENPNIPRGTEDSRGSASGPAGVRLTLVLALTVILELT
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcaagctgctccaagcctccgccgcgcttcctgcctgctgctcgccgcgattctggac
ctggcacgcggctacctgacagtcaacattgagccccttccccctgtggtggctggggac
gcagtgaccctgaagtgtaacttcaagacagacggccgtatgcgtgagatcgtgtggtac
cgggtgacagatggcggcaccatcaagcagaagatcttcacgtttgacgccatgttctcc
acgaactactcgcacatggagaattaccgcaagagggaggaccttgtgtatcagtccacc
gtgaggctgcccgaggtccggatctcagacaatggtccctatgagtgccacgtgggtatc
tacgaccgagccacgagggagaaggtggtcctcgcctcaggcaacatcttcctcaatgtc
atggctcctcccacctccatcgaagtcgtggctgctgactcccctgccccctttagccgg
taccaggcccagaacttcacactggtctgcatcgtgtcaggagggaagccggcgcccatg
gtttatttcaaacgggacggggagccgatagatgccgtgcccctgacagaactgccagca
gccagctctggcccagtccaggacagcaggcccttccgaagccttctgcaccgagacgtg
gatgataccaaaatgcaaaagtcactgtcccttctggacactgaataccgggctggacgt
ccctacacggagcgccccgcgcgcagcctgacccaggaccccagcctcttcgtgcagccc
accacggaaaacatcccagagacagtggtgagccgagagttcccccgttgggtacacagc
gccgagccggtctacttcctgcgccacagccgcaccccaggcagcgatggcacggtggag
gtgcgggccctgctcacctggaccctcaacccgcagatcgacaatgaggccctcttcagc
tgtgaggtcaagcacccagcgctgtccatgcccatgcaggcggaggtcacgctggttgct
cccaaaggacccaaaatcatgatgacgcccagcagagcccgggttggggacacagtgagg
atcctagtccacggatttcagaatgaggtcttcccagaacccatgttcacgtggacgaga
gtgggcagccgcctcctggatggcagtgccgagtttgacgggaaggagcttgtgctggag
cgggttcctgccgagctcaacggctccatgtaccgctgcactgcccagaaccccctgggc
tccactgatacacacactcggctcatcgtgttcgaaaacccaaatatcccaagaggaaca
gaggactcccgtggttctgcttccggccccgctggcgtccggctcaccctggtgcttgcc
ctgacagtgatcctggagctcacgtga

DBGET integrated database retrieval system