KEGG   Mus musculus (mouse): 230899
Entry
230899            CDS       T01002                                 

Gene name
Nppa, A, ANP, Anf, CDD, P, Pnd
Definition
(RefSeq) natriuretic peptide type A
  KO
K12334  natriuretic peptide A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04714  Thermogenesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    230899 (Nppa)
   04024 cAMP signaling pathway
    230899 (Nppa)
   04022 cGMP-PKG signaling pathway
    230899 (Nppa)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    230899 (Nppa)
   04921 Oxytocin signaling pathway
    230899 (Nppa)
   04924 Renin secretion
    230899 (Nppa)
   04925 Aldosterone synthesis and secretion
    230899 (Nppa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    230899 (Nppa)
  09159 Environmental adaptation
   04714 Thermogenesis
    230899 (Nppa)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    230899 (Nppa)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 230899
NCBI-ProteinID: NP_032751
MGI: 97367
Ensembl: ENSMUSG00000041616
Vega: OTTMUSG00000010192
UniProt: P05125
Position
4 E1; 4 78.66 cM
AA seq 152 aa
MGSFSITLGFFLVLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQ
ALSEQTEEAGAALSSLPEVPPWTGEVNPPLRDGSALGRSPWDPSDRSALLKSKLRALLAG
PRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR
NT seq 459 nt   +upstreamnt  +downstreamnt
atgggctccttctccatcaccctgggcttcttcctcgtcttggccttttggcttccaggc
catattggagcaaatcctgtgtacagtgcggtgtccaacacagatctgatggatttcaag
aacctgctagaccacctggaggagaagatgccggtagaagatgaggtcatgcccccgcag
gccctgagtgagcagactgaggaagcaggggccgcacttagctccctccccgaggtgcct
ccctggactggggaggtcaacccacctctgagagacggcagtgctctagggcgcagcccc
tgggacccctccgatagatctgccctcttgaaaagcaaactgagggctctgctcgctggc
cctcggagcctacgaagatccagctgcttcgggggtaggattgacaggattggagcccag
agtggactaggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system