KEGG   Mus musculus (mouse): 230904
Entry
230904            CDS       T01002                                 

Gene name
Fbxo2, FBG1, FBX2, Fbs, Fbs1, Fbs2, NFB4, NFB42, P, Prpl4
Definition
(RefSeq) F-box protein 2
  KO
K10099  F-box protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    230904 (Fbxo2)
   04120 Ubiquitin mediated proteolysis
    230904 (Fbxo2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    230904 (Fbxo2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    230904 (Fbxo2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     230904 (Fbxo2)
Lectins [BR:mmu04091]
 F-box lectins
  230904 (Fbxo2)
SSDB
Motif
Pfam: FBA F-box F-box-like
Other DBs
NCBI-GeneID: 230904
NCBI-ProteinID: NP_789818
MGI: 2446216
Ensembl: ENSMUSG00000041556
Vega: OTTMUSG00000010936
UniProt: Q80UW2 Q3USR5
Structure
PDB: 

Position
4 E2; 4 78.68 cM
AA seq 297 aa
MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEAEAVEYLAELPEPLLL
RVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQFYFL
SKRRRNLLRNPCGEEDLEGWSDVEHGGDGWRVEELPGDNGVEFTQDDSVKKYFASSFEWC
RKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFAT
GQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
NT seq 894 nt   +upstreamnt  +downstreamnt
atggatggagatggtgatccagagagtgtgagccaccccgaagaagcgagcccagaggag
cagccagaggaggcgggcgccgaggcgagtgcggaggaggagcagctccgggaggcggag
gaggaggaagaggcggaggccgtggagtacctggccgagctgccggagccactgctgctg
cgcgtgctggccgagctgccagctacggagctggtgcaggcctgccgcctggtgtgcctg
cgctggaaggagctggtggacggcgccccactgtggctgctcaagtgccagcaggagggg
ctggtgcccgagggcagcgctgatgaggagcgggaccactggcaacagttctactttctg
agcaagaggaggcgcaacctgctgcgcaacccttgtggggaagaggacttggagggctgg
agcgacgtggagcacggtggggacggctggagggtggaggaactgcccggagacaatggg
gtggaatttacccaagatgacagcgttaagaaatacttcgcctcctccttcgagtggtgt
cgcaaagcgcaggtcattgatctgcaggcagagggctactgggaggagctactggacacc
acccagcccgccatcgtggtgaaggactggtactcgggtcgcactgatgcgggcagcctg
tatgagctcactgtgaggctgctgtcggagaacgaagatgtgctggcggagttcgctaca
ggacaggtggctgtgccagaggacggcagttggatggagatctcccacaccttcatcgac
tacgggccaggtgtccgctttgtccgcttcgagcacggagggcaggactcggtctactgg
aagggctggttcggggcccgggtgaccaacagtagcgtgtgggtggaaccctga

KEGG   Mus musculus (mouse): 50762
Entry
50762             CDS       T01002                                 

Gene name
Fbxo6, AA408845, FBG2, Fbs, Fbs2, Fbx6b, Fbxo6b
Definition
(RefSeq) F-box protein 6
  KO
K10100  F-box protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    50762 (Fbxo6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50762 (Fbxo6)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    50762 (Fbxo6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     50762 (Fbxo6)
Lectins [BR:mmu04091]
 F-box lectins
  50762 (Fbxo6)
SSDB
Motif
Pfam: FBA F-box-like F-box
Other DBs
NCBI-GeneID: 50762
NCBI-ProteinID: NP_001157176
MGI: 1354743
Ensembl: ENSMUSG00000055401
Vega: OTTMUSG00000010945
UniProt: Q9QZN4
Position
4 E2; 4 78.67 cM
AA seq 295 aa
MVHINELPENILLELFIHIPAPQLLRNCRLVCRLWRDLIDVVSLWKRKSLREGFFTKDRC
EPVEDWKVFYILCSLQRNLLRNPCAEENLSSWRIDSNGGDRWKVETLPGSCGTSFPDNKV
KKYFVTSFEMCLKSQMVDLKAEGYCEELMDTFRPDIVVKDWVAPRADCGCTYQLRVQLAS
ADYIVLASFEPPPVTFQQWNDAKWQEISHTFSDYPPGVRHILFQHGGQDTQFWKGWYGPR
VTNSSIIISHRTAKNPPPARTLPEETVVIGRRRRASDSNTHEGFFWQGLWQRLRR
NT seq 888 nt   +upstreamnt  +downstreamnt
atggtccacatcaacgagctgccagagaacattctcctggagctgttcatccatatcccg
gccccacagctgctgcgcaactgccgcctggtctgccgcctctggcgagacctcatcgat
gtggtgtccctatggaagcgcaagagtcttcgagagggcttcttcaccaaagaccggtgc
gagcccgtggaagactggaaggtcttctatatcctgtgcagcctgcagaggaacctcctt
cggaacccgtgtgctgaagagaacctgagctcatggcggatagactccaacggaggggat
cgctggaaggtggagacgctccctgggagctgtggcacaagctttcctgacaacaaggtc
aagaagtattttgtcacctcttttgagatgtgcctcaaatcccagatggtggacctcaaa
gctgagggctactgcgaggagctgatggacacctttcggcctgacattgtggttaaggac
tgggttgcccccagagcagactgtggctgcacctatcaactccgggtacagctggcctct
gcggactacattgtcttggcctcttttgagcctccacctgtgacattccaacagtggaat
gatgccaaatggcaagagatttcccacaccttctctgattaccctccaggtgtccgtcac
atcctttttcaacacgggggccaggacactcagttctggaaaggctggtacggcccccgt
gtcaccaacagcagcatcattatcagccacaggacagccaagaaccctccccctgccaga
actctaccggaagaaactgtagtaatcggaaggagacggcgagcttcggactccaacact
catgagggtttcttctggcaagggctatggcaaaggctaaggcgttag

DBGET integrated database retrieval system