KEGG   Mus musculus (mouse): 230936Help
Entry
230936            CDS       T01002                                 

Gene name
Phf13, BC029632, Phf5, SPOC1
Definition
(RefSeq) PHD finger protein 13
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PHD PHD_2 NUDE_C zf-HC5HC2H C1_1 FYVE_2 zf-CW
Motif
Other DBs
NCBI-GeneID: 230936
NCBI-ProteinID: NP_766293
MGI: 2446217
Ensembl: ENSMUSG00000047777
Vega: OTTMUSG00000010357
UniProt: Q8K2W6 Q3V230
Position
4; 4 E2
AA seq 296 aa AA seqDB search
MDSDSCAAAFHPEEYSPTCKRRRTVEDFNKFCTFVLAYAGYIPYPKEELPLRSSPSPANS
TAGTIDSDGWDTGFSDITPSVPDRCFSHLQPSLLQRAKPSNYLLDRKTTDKLKKKKRRKR
RDSDIPVKEGFRESLLKLEAADPYVETPSSPTMQDIPQASADPCSGWDSDTPSSGSCATV
SPDQVTEIKTEGKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGR
PMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSKFDIRRSNRSRMGSRKLFLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggactccgactcctgcgccgccgccttccaccccgaggagtactcccccacttgtaag
aggcgccggactgtggaagacttcaacaaattctgcaccttcgtcttggcatatgcgggc
tacatcccctacccaaaggaggagctccccctgaggagcagtcccagccccgccaacagc
actgccgggaccattgacagcgacggctgggacactggtttctctgacatcacgccttca
gtgcccgaccgatgcttcagccacctgcagccttccctcttgcagagagctaagcccagt
aactaccttctggacaggaagacaactgacaagctgaagaagaagaagaggaggaagcgc
agggacagcgacatacctgtgaaggagggattcagggagagcctgctgaagctggaagct
gcagacccatatgtggagactccctcaagccccaccatgcaggatattccccaggcgtct
gctgacccctgctcaggctgggactctgacacaccctcaagtggctcttgtgctactgtg
tcacctgatcaggtcacagaaataaaaactgaaggaaaacggactattgtccgccaggga
aagcaggtggtgttccgagacgaagacagcactggcaatgatgaagacatcatggtggac
tcagatgatgattcctgggacctcgtcacctgtttctgcatgaagccctttgccggccgc
cccatgatcgagtgtaacgagtgccacacctggattcacctgtcctgtgcaaagatccgc
aagtccaatgtcccggaagtttttgtctgccaaaagtgccgggactccaagtttgatatc
cgtcgctccaaccggtcccgaatgggctcccggaagctgtttctggactga

DBGET integrated database retrieval system