KEGG   Mus musculus (mouse): 230959
Entry
230959            CDS       T01002                                 

Symbol
Ajap1, Gm573
Name
(RefSeq) adherens junction associated protein 1
  KO
K21387  adherens junction-associated protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    230959 (Ajap1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     230959 (Ajap1)
SSDB
Motif
Pfam: AJAP1_PANP_C Stomagen
Other DBs
NCBI-GeneID: 230959
NCBI-ProteinID: NP_001092769
MGI: 2685419
Ensembl: ENSMUSG00000039546
Vega: OTTMUSG00000010367
UniProt: A2ALI5
Position
4:complement(153457678..153568313)
AA seq 412 aa
MWIQQLLGLSSMSIRWPGRSLGSHAWILIAMLQLAVDFPSCDSLGPGPEFRLLSRPQRPQ
RLWSLRSGPPTRLPTPAWSPRAARAERAHGPIQMQTPRARRAHRPRDQVATLGPKGGLTK
PPAATRSSPSLASATASSSIVTAGAAEHQGLLRRGRRHTHDTEFNDFDFRGGRPTTETEF
IAWGPTGDEDALESNTFPGGFGPTTVSILQTRKTTVATTTTTTAASTATAMTLQTKGVTE
SLDPWKRTPVGVSTTEPSTSPSSNGKDIQPPRILGETSGLAVHQIITITVSLIMVIAALI
TTLVLKNCCAPSGHTRRNSHQRKMNQQEESCQNLTDFTPARVPSSVDIFTAYNETLQCSH
ECVRASVPVYADETLHSTGEYKSTFNGNRTSSADRHLIPVAFVSEKWFEISC
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtggatccaacagcttttaggactcagctccatgtctatccgctggcccggccgctct
ctcggaagccatgcctggatactgatagccatgctgcagcttgcggtcgacttcccatcc
tgtgactcactaggccctgggcccgagttccggctcctgtcacgcccacagaggccccag
cggctgtggagtctgcgaagtggacccccaacgaggctaccgacaccggcctggagtccc
cgtgctgcccgggcagaacgtgcccacggacccatacagatgcagactccccgtgctcgg
agggcccacaggcccagggaccaggtagccaccctcggacccaaagggggactcaccaag
cccccagctgccaccaggtcgagcccttccctcgcctctgcgacggcctcatcctccata
gtgactgctggggctgcagagcaccagggcctcctaagacggggtaggaggcacacacat
gatacagagttcaacgatttcgacttccgtggtggcaggcccacgacagagacagaattc
atagcctgggggcctacgggggatgaggacgccctggagtccaacaccttccctggtggt
ttcggccccaccacggtctccatcttgcaaacacggaagacaacggtggccaccaccacc
accaccaccgcggccagcacggccaccgccatgacactgcagactaagggggtcaccgag
tccctggatccctggaaaaggacccctgttggggttagcacaacggagccttccactagt
cccagcagcaatgggaaagacatccagcccccgaggatcttaggggagacctcaggtctg
gctgtgcatcagatcatcaccatcaccgtctccctcatcatggtcatcgctgcgctcatc
acaactcttgtcttaaaaaattgctgtgccccaagcgggcacactcggaggaatagccac
cagcggaagatgaatcagcaggaggagagttgccagaacttgacggacttcaccccggcc
cgggtgcccagcagtgtggacatcttcaccgcctataatgagacactgcagtgttctcac
gagtgtgtcagggcctctgtgcccgtgtatgccgacgagacgctgcactcgaccggggag
tacaagtccacattcaacggaaaccgaacatcctctgcggataggcatctcatccctgtg
gcctttgtgtctgagaaatggtttgaaatctcctgctga

DBGET integrated database retrieval system