KEGG   Mus musculus (mouse): 230979Help
Entry
230979            CDS       T01002                                 

Gene name
Tnfrsf14, Atar, HveA, Hvem, TR2, Tnfrs14
Definition
(RefSeq) tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
  KO
K05152  tumor necrosis factor receptor superfamily member 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230979 (Tnfrsf14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    230979 (Tnfrsf14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    230979 (Tnfrsf14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    230979 (Tnfrsf14)
   04090 CD molecules [BR:mmu04090]
    230979 (Tnfrsf14)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   230979 (Tnfrsf14)
CD molecules [BR:mmu04090]
 Proteins
  230979 (Tnfrsf14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 230979
NCBI-ProteinID: NP_849262
MGI: 2675303
Ensembl: ENSMUSG00000042333
Vega: OTTMUSG00000010461
UniProt: Q80WM9
Position
4; 4 E2
AA seq 275 aa AA seqDB search
MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPG
YHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCR
CIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECL
PWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGAGIAGFLICTRRHLHTSS
VAKELEPFQEQQENTIRFPVTEVGFAETEEETASN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaacctctcccaggatgggggtcggcaccctggagccaggcccctacagacaacacc
ttcaggctggtgccttgtgtcttccttttgaacttgctgcagcgcatctctgcccagccc
tcatgcagacaggaggagttccttgtgggagacgagtgctgccccatgtgcaacccaggt
taccatgtgaagcaggtctgcagtgagcatacaggcacagtgtgtgccccctgtccccca
cagacatataccgcccatgcaaatggcctgagcaagtgtctgccctgcggagtctgtgat
ccagacatgggcctgctgacctggcaggagtgctccagctggaaggacactgtgtgcaga
tgcatcccaggctacttctgtgagaaccaggatgggagccactgttccacatgcttgcag
cacaccacctgccctccagggcagagggtagagaagagagggactcacgaccaggacact
gtatgtgctgactgcctaacagggaccttctcacttggagggactcaggaggaatgcctg
ccctggaccaactgcagtgcatttcaacaggaagtaagacgtgggaccaacagcacagac
accacctgctcctcccaggtcgtctactacgttgtgtccatccttttgccacttgtgata
gtgggagctgggatagctggattcctcatctgcacgcgaagacacctgcacaccagctca
gtggccaaggagctggagcctttccaggaacaacaggagaacaccatcaggtttccagtc
accgaggttgggtttgctgagaccgaggaggagacagcctccaactga

DBGET integrated database retrieval system