KEGG   Mus musculus (mouse): 231086Help
Entry
231086            CDS       T01002                                 

Gene name
Hadhb, 4930479F15Rik, Mtpb, TP-beta
Definition
(RefSeq) hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit
  KO
K07509  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00085  Fatty acid biosynthesis, elongation, mitochondria
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    231086 (Hadhb)
   00071 Fatty acid degradation
    231086 (Hadhb)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    231086 (Hadhb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     231086 (Hadhb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-GeneID: 231086
NCBI-ProteinID: NP_001276727
MGI: 2136381
Ensembl: ENSMUSG00000059447
Vega: OTTMUSG00000024744
UniProt: Q99JY0
Position
5; 5 B1
AA seq 475 aa AA seqDB search
MTTILTSTFRNLSTTSKWALRSSIRPLSCSSQLHSAPAVQTKSKKTLAKPNMKNIVVVEG
VRIPFLLSGTSYKDLMPHDLARAALSGLLHRTNIPKDVVDYIIFGTVIQEVKTSNVAREA
ALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIASGQCDVVVAGGVELMSDVPIRHSRNM
RKMMLDLNKAKTLGQRLSLLSKFRLNFLSPELPAVAEFSTNETMGHSADRLAAAFAVSRM
EQDEYALRSHSLAKKAQDEGHLSDIVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKP
YGTVTAANSSFLTDGASAMLIMSEDRALAMGYKPKAYLRDFIYVSQDPKDQLLLGPTYAT
PKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAQNYMGRKTKVGSPPLEKFNI
WGGSLSLGHPFGATGCRLVMAAANRLRKDGGQYALVAACAAGGQGHAMIVEAYPK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgactaccatcttgacttccacttttagaaacttgtcaactacatcaaaatgggctctc
agatcttctataagacctctgagctgttcttcccaactgcactctgccccagctgtccag
accaagtcaaagaagactttagcaaaacccaatatgaagaatattgtggtggtggaaggg
gtccgcattccatttctgctgtcaggcacttcgtataaagacctaatgccacatgacttg
gctagagctgcactttcgggtttgttgcatcggaccaatattccaaaggatgttgttgat
tatatcatctttggtacagttattcaggaagtgaaaacaagcaatgtggctagagaggct
gccctgggagctggcttctctgataagactccagctcacactgtcaccatggcttgtatc
tcttcaaaccaagccatgaccacagctgttggtctgatagcttctggccagtgtgatgtc
gtcgtggctggtggtgttgagttaatgtctgatgtccctattcgtcattcaagaaatatg
aggaaaatgatgcttgatctcaataaagccaagactctgggccagcgcctgtccttactc
agtaaattcagattgaattttctgtcccctgagctccctgcagtggctgagttctccact
aatgagaccatgggccactctgcagaccgactggctgctgcctttgctgtttctcgaatg
gaacaggatgaatatgcactgcgttctcatagtctggccaagaaggcacaggatgaagga
cacctttctgatattgtacccttcaaagtaccaggaaaggacacagttaccaaagataat
gggatccgtccttcctcactggagcaaatggccaaactaaaacctgcgttcatcaaaccc
tatggcacagtgacagctgcaaattcttctttcctgactgatggcgcttctgcgatgcta
atcatgtcagaggacagagctctggccatgggttataaaccaaaggcatatttgagggat
tttatatatgtgtcccaggatccgaaagatcagcttttactcggaccaacatatgctact
ccaaaagttttagaaaaggcagggttaaccatgaatgatatcgatgcttttgaatttcat
gaagccttctcaggccagattttagctaactttaaagccatggattctgattggtttgca
caaaactacatgggtaggaaaaccaaggttggatcacctcctctggagaagtttaatatc
tggggcggatcactgtctctggggcacccttttggagccactggctgtcggctggtcatg
gcagctgccaacagactgaggaaggatggaggccagtatgctttagtggctgcctgtgca
gctggaggacagggtcatgctatgattgtggaagcttaccccaaatga

DBGET integrated database retrieval system