KEGG   Mus musculus (mouse): 231093
Entry
231093            CDS       T01002                                 

Symbol
Agbl5, 9430057O19Rik, CCP5, Ccp
Name
(RefSeq) ATP/GTP binding protein-like 5
  KO
K23438  cytosolic carboxypeptidase protein 5 [EC:3.4.17.24]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    231093 (Agbl5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.24  tubulin-glutamate carboxypeptidase
     231093 (Agbl5)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   231093 (Agbl5)
SSDB
Motif
Pfam: Peptidase_M14 Pepdidase_M14_N
Other DBs
NCBI-GeneID: 231093
NCBI-ProteinID: NP_001041657
MGI: 2441745
Ensembl: ENSMUSG00000029165
Vega: OTTMUSG00000022346
UniProt: Q09M02
Position
5; 5 B1
AA seq 846 aa
MELRCGGLLFSSRFDSGNLAHVEKVETVSSDGEGVGGVATAPASGSAASPDYEFNVWTRP
DCAETEYENGNRSWFYFSVRGGTPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPSRPRWE
RIRERPTFELGSKLSPCFSKPEEAGSHVESVRGRELVKMTETQFVLSFVHRFVEGRGATT
FFAFCYPFSYSDCQDLLSQLDQRFSENYSTHSSPLDSIYYHRELLCYSLDGLRVDLLTIT
SCHGLRDDREPRLEQLFPDLGTPRPFRFTGKRIFFLSSRVHPGETPSSFVFNGFLDFILR
PDDPRAQTLRRLFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLKPDAVLHPAIYGAKA
VLLYHHVHSRLNAKSPTNQQPTLHLPPEAPLSDLEKANNLHNEAHLGQSPDGENPATWPE
TEPAEEKTDPVWLMPQPIPELEEPAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFSD
ESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIH
SYTLECNYNTGRSVNSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAE
CNPWPRIVLSEHSSLTNLRAWMLRHVRNSRGLTSAGNMGASKKRGARTPPKSNNSLPVSC
SENALSRVRSFSTGTSTGGSSSSQQNSPQMKNSPSFPFHGSRTAGLPGLGSSTQKVSHRV
LGPVREPRCSDRRRRQQPLNHRSTTSSLAPSPTLASSGPTSSRNMGSCLLPNSLSLSGSS
CSFSSSGDKPEAVMVIGKSLLGAGARIPCIRTRLQTCQRRVSARRGPGFPRLGPGWAGAH
RRLAEG
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggagctgcgctgtgggggattgctgttcagttctcgctttgattcagggaacctagcc
catgtggaaaaggtggagactgtgtctagtgatggggaaggcgtaggaggggtggcaaca
gcccccgctagtgggtctgctgcttcccctgactacgagttcaacgtgtggacccggcct
gactgtgctgaaacggaatatgaaaatggcaacaggtcatggttctacttcagtgtccgg
ggagggactccaggaaagcttatcaagatcaacattatgaacatgaacaagcaaagcaaa
ctgtattcccagggcatggccccctttgtgcgcacactgccttcccggccacgctgggaa
cgcattagagagcggcccacctttgagctggggtccaagctgagcccctgcttcagcaag
cctgaagaagctggttctcatgtggagagtgtcagagggagggagttggtaaagatgaca
gagacacagtttgtgctatcctttgttcaccgtttcgtagagggccggggagccaccacc
ttcttcgccttctgctaccccttctcctacagtgactgccaggatctgctgagccagcta
gaccagcgcttttcagagaattactctacccatagcagtcctctggatagtatttattac
caccgagagcttctctgctattctctggatggacttcgtgtagatctactaacaatcact
tcctgccatgggcttcgagatgatcgggagccccgactagagcagctatttcctgatctc
ggcactccccgaccattccgtttcacaggcaaaaggatattcttcttaagcagtagggta
caccctggagagactccatctagctttgtgttcaatggctttctggacttcatccttcga
cctgatgatccccgggcacaaactctccgtcgactctttgtttttaagttgattcccatg
ttaaaccctgatggtgtggtccggggccactaccgcacggactcccgtggagtgaatctg
aaccgtcagtacttgaagcctgatgccgtcctgcacccggccatctatggcgccaaagct
gtgctgctttatcatcacgtgcactcgaggctcaacgccaagagtcccacgaaccagcaa
cccactctccatctccctccggaagcccctctctctgacctcgagaaagccaataatctc
cacaatgaagctcacctcgggcagtcacctgatggggaaaaccctgcgacttggcctgag
acagagccagcagaagagaagactgaccctgtgtggcttatgccacagccaattcctgaa
ctcgaggagccagcccctgacaccatccccccaaaagagagtggtgttgcttactatgta
gacttgcacggacatgcttccaaaaggggctgcttcatgtatggcaacagctttagtgac
gagagcacccaggtggaaaacatgctatatccaaagctcatctccttgaattcagcccac
tttgacttccagggctgcaatttctcagagaagaacatgtatgcccgagaccgtagagat
ggccagtccaaagagggaagcggccgtgtcgcaatctacaaagcctcagggataatccac
agctacacacttgaatgcaactacaacactggacgctcagtcaacagcatccctgctgcc
tgccatgacaacgggcgcgccagcccccctccccctccggctttcccctccagatacact
gtggaactattcgagcaggtggggcgagctatggccatcgcagctctggacatggcagag
tgtaatccgtggccccgaattgtgctgtcggaacacagcagcctcaccaacctgcgagcc
tggatgctgaggcacgtgcgcaacagcagagggctgaccagtgctgggaacatgggcgcg
agcaagaagcgaggggctcgaacccctcccaaaagcaacaacagcttgcctgtttcctgc
tctgaaaatgctctgagccgggttcgcagttttagcaccggcacgagtactggtggcagc
agcagcagccaacaaaactctccacagatgaagaactctcccagcttcccttttcatggc
agtcggactgcggggctaccaggcctgggctctagcacccaaaaggtcagccatcgggtg
ctgggccctgtcagagagccccgatgctcagacagaaggcggcgacagcagccactgaac
catcgctctaccacaagcagcctggccccatccccaactctggctagttctggcccaacc
tcctcacgaaacatgggctcctgcctcctacccaattcactcagcttatcagggagcagc
tgctcattctcgtcttcaggggacaagccagaggctgtcatggtgattgggaaaagccta
ctaggggctggtgctcggatcccttgcattaggactcgattgcagacctgccagaggaga
gtttccgccaggaggggtcccggattccccaggctaggcccaggttgggccggagctcac
cgccgactcgcagagggatga

DBGET integrated database retrieval system