KEGG   Mus musculus (mouse): 231103Help
Entry
231103            CDS       T01002                                 

Gene name
Gckr, GKRP
Definition
(RefSeq) glucokinase regulatory protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 231103
NCBI-ProteinID: NP_659158
MGI: 1096345
Ensembl: ENSMUSG00000059434
Vega: OTTMUSG00000055211
UniProt: Q91X44
Position
5 B1; 5 17.27 cM
AA seq 587 aa AA seqDB search
MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKADAEKIVQLLGQCDAEI
FQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGKKRVVVIGISV
GLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQ
EAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGVVSSQRCLLEILRTFE
RAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGIIAIMDGVECIHTFGADFRDI
RGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPSLTEIDTVVFIFTLDDNLAEVQ
ALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLISITWPLLFFDYEGSYVQKFQREL
STKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALL
SLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcaccaagcggtatcagcatgtgatcgagacccctgagcctggggaatgggag
ttgtcagggtatgaagcagctgtgccaatcacagagaagtccaacccactgacccggaac
ttggacaaagcagatgcagagaaaattgttcaactgctggggcagtgtgatgctgagata
ttccaggaggaggggcaaatcatgcccacctaccagcgactgtacagtgagtcagttctg
accaccatgttgcaagtggctggcaaggtccaggaagtgctgaaggagccagatgggggc
ctggtggtgctgagtggagggggcacctctggtcgtatggcattccttatgtctgtgtct
ttcaaccagctgatgaaaggtctgggacaaaaacctctttacacatacctcattgcaggg
ggtgacaggtctgttgtagcctctcgggaacggacagaagatagcgccctacacggaatc
gaggagctgaagaaggtggctgctgggaaaaagagagtggtcgttataggcatttccgtg
ggactctctgcgccctttgtggcaggccagatggactactgcatggataacacagctgtc
ttcttgccggtcctggttggcttcaatccggtgagcatggccagaaatgatcccattgaa
gactggagatcgacattccgacaagtggcagagcggatgcagaagatgcaggagaaacag
gaagcctttgtgctcaatcctgccatcgggcctgaggggctcagtggctcttcccgaatg
aaaggtggaagcgccaccaagattctactggaaaccctgctactagcagcccataagact
gtggaccagggtgttgtgtcctctcaaagatgccttctggaaatcctgaggacatttgag
cgggctcatcaggtaacctacagtcaaagttccaaaattgccactctgacgaagcaagtt
ggcatcagcctggagaaaaaaggccacgtgcacttggttggctggcagaccctcggtatc
atcgccattatggatggggtagagtgtatccacacttttggtgctgatttccgagatatc
cgtggctttcttattggtgaccacaatgacatgtttaaccagaaggatgagctcagcaat
cagggtccccagttcaccttctctcaggatgacttcctgacttctgttctgccatccctt
acggaaattgacactgtggtcttcatttttaccctggatgataacctcgcagaagtacag
gccctggcagaaagggtgagggagaagagttggaacatccaggccctggtgcacagcaca
gtggggcagtccttgccagctcctctaaagaagctctttccctcgctcatcagcatcaca
tggccacttcttttcttcgattatgaagggagctacgttcagaagttccagcgtgagtta
agcaccaagtgggtgttgaatacaaggttctcaggacagtccaaggctcgctgcattgag
agtcttcttcaagtgatacatttccctcaaccgctgtcgaatgatgtccgcgcggccccc
atctcctgccatgtccaggttgcccacgagaaggaaaaggtgatccccacagccttgctg
agtctcctactcaggtgctccatcactgaggctaaggaacgcctggctgcagcttcttca
gtctgtgaggttgttaggagcgccctctctgggccaggtcagaaacgcagcatccaagcc
tttggagaccctgtggtgccctga

DBGET integrated database retrieval system