KEGG   Mus musculus (mouse): 231148
Entry
231148            CDS       T01002                                 

Gene name
Ablim2, AI606905, C230091L11
Definition
(RefSeq) actin-binding LIM protein 2
  KO
K07520  actin-binding LIM protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    231148 (Ablim2)
Motif
Pfam: AbLIM_anchor LIM VHP
Other DBs
NCBI-GeneID: 231148
NCBI-ProteinID: NP_808346
MGI: 2385758
Ensembl: ENSMUSG00000029095
Vega: OTTMUSG00000024832
UniProt: Q8BL65
Position
5; 5 B3
AA seq 612 aa
MSAVSQPQAAHAPLEKPASTAILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEG
GFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECMCQKCSPPTLLGNSAHVAQGLRSCGGCGLEIKNGQALVALDKHWHLGCFKC
KTCGKLLNAEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVR
CGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIVSVPASSTSGSPSRVIY
AKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISHSAVGDRQSYGEGDQDDRSYKQ
CRTSSPSSAGSVSLGHYTPTSRSPQHYSRPGSESGRSTPSLSVHSDSRPPSSTYQQAPRH
FHVPDTGVKDNIYRKPPIYKQHAARRLDVEDSSFDQDSRKKTTWLLLKGDADTRTNSPDL
DSQSLSLSSGTDQEPLQRMAGDSLYSRFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDA
SWGTREYKIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALW
KRNDLKKKALLF
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgagcgcagtgtcgcagccccaggctgctcatgccccactggagaagccggccagcact
gcgatcctgtgtaatacctgtgggaatgtgtgcaagggagaggtgctgcgtgtgcagaac
aagtacttccacatcaggtgctttgtgtgcaaagcgtgtggctgtgacctggctgagggt
ggcttcttcgtgaggcagggtgagcacatttgcacacgtgactaccagcggctctatggc
actcgctgcttcagctgtgaccgcttcattgaaggcgaagtggtgtcggcgcttgggaag
acctaccaccctgactgcttcgtgtgtgctgtctgcaggctgccctttcctcctggggac
cgtgtgaccttcaacgggaaggagtgtatgtgccagaagtgttccccacccacattgctg
ggcaacagtgctcacgtggcccagggcctccggagttgtgggggctgtggcttagaaatc
aagaatggccaggccctggtggctttggacaagcactggcacctgggatgcttcaagtgc
aagacttgtgggaaactcctcaatgcagagtacatcagcaaggacgggctgccctactgc
gaggctgattatcacagcaagtttggcatccgctgcgacggctgtgagaagtacatcacg
ggccgggtgctagaggccggagagaagcactaccacccttcatgtgcgctatgcgtcagg
tgcggccagatgttctcagagggcgaggagatgtacctgcaaggctcctccatctggcat
ccggcatgtcgacaggcagccaggactgaagacaagagcaaggaaaccaggacttcttcg
gagagcattgtctccgtgcctgcctccagcacgtcagggtccccgagccgtgtgatctac
gcaaagcttggcgatgagatcctggactacagggacttggctgctcttcccaaaaacaaa
gcgatctacaacatcgaccgccccgacatgatctcctattcgccctacattagccactcg
gccgtgggggacaggcagagctatggcgagggggatcaggatgatcggtcctacaagcag
tgcaggacctccagccccagctctgccggctcagtcagcctcggacactacaccccaacc
tcacggtcaccccagcactacagtcgtccaggcagcgaaagtggccgtagcaccccgagt
ctctcagtgcactccgacagcagacctccttcctctacctaccagcaggctccgagacac
ttccacgtcccagacactggcgtaaaagataacatctataggaaaccccctatctacaaa
cagcacgctgccaggcgattggacgtggaggacagcagctttgaccaggacagcaggaag
aagacaacctggctgcttctcaagggggatgcagacaccagaactaactctccagacctg
gacagtcagtcgctgtccctcagcagcgggactgaccaggaacctctccaaagaatggca
ggggacagcctctactcacgctttccttattccaaacctgacactcttccaggacccagg
aaggatggcctggacctccggaatgccaacctggccccttgtggagcagacccggatgcc
agctggggcacgcgagagtataagatatatccctatgattccctcatcgtaacaaaccga
attcgtgtgaaactgcccaaagacgtggaccggacacggctggagagacacctatcacct
gaggagttccaagaagtgtttgggatgagcatcgaggagtttgaccgcctggccctgtgg
aagaggaatgacctcaagaagaaagccttgctgttctga

DBGET integrated database retrieval system