KEGG   Mus musculus (house mouse): 231162
Entry
231162            CDS       T01002                                 
Symbol
Cytl1, 4930443F05Rik, 4Cytl1, C17, Cyt1, Gm147
Name
(RefSeq) cytokine-like 1
  KO
K25418  cytokine-like protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    231162 (Cytl1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   231162 (Cytl1)
SSDB
Motif
Pfam: CYTL1
Other DBs
NCBI-GeneID: 231162
NCBI-ProteinID: NP_001074575
MGI: 2684993
Ensembl: ENSMUSG00000062329
UniProt: A1E5L0
Position
5:37892863..37897164
AA seq 139 aa
MSPKTLPLLLLLVVVVIAWPLAVQSAPPTCYSRMLTLSREIMADFQSLQASEPEDSCVRY
LPRLYLDIHNYCVLAKLRDFVASPQCWKMAEVDTLKDRVRKLYTIMNSFCRRDLVFLSDD
CSALEDPIPEATGPPDWQS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtcaccaaagacactacctctgttgctgctgctggtggtggtggtgatagcctggcct
ctggcagtacagtccgcgccccccacctgctactctcggatgctgaccctgagccgtgag
atcatggcagacttccagagcctgcaggcttcagagcctgaggattcctgtgtgaggtac
ttgccccggctttacctggacatccataactactgtgtgctggccaagctgagagacttc
gtggcttctcctcagtgctggaagatggccgaagtggacactctgaaggacagagtgcgg
aagctgtataccatcatgaactccttctgcaggcgggacttggtattcctctcagatgac
tgcagtgccttagaagacccaattcccgaggccacgggtcctccagactggcagagctaa

DBGET integrated database retrieval system