KEGG   Mus musculus (house mouse): 231214
Entry
231214            CDS       T01002                                 
Symbol
Cc2d2a, 5730509K17Rik, b2b1035Clo
Name
(RefSeq) coiled-coil and C2 domain containing 2A
  KO
K19352  coiled-coil and C2 domain-containing protein 2A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    231214 (Cc2d2a)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  MKS complex
   231214 (Cc2d2a)
SSDB
Motif
Pfam: DUF5523 CC2D2AN-C2 C2 DUF3987
Other DBs
NCBI-GeneID: 231214
NCBI-ProteinID: NP_758478
MGI: 1924487
Ensembl: ENSMUSG00000039765
UniProt: Q8CFW7
Position
5:43819715..43898317
AA seq 1633 aa
MNTNDEKMKIISEDFTGDGVDTEAGRRKKNSKVRRQQRKKKPPASPPEEMVSDKFQDGGQ
QEVVEEEPETNLLSLTARRGPRSLPPIPSASRTGFAEFSMRERMREKLQAARSKAESALL
RDVPTPRPRRLRSPSREKETETEFGTEPSTEVQDTQKEDDTKSYSRIKFRDSVRKIKSKP
QLPPGFPSAEEAYNFFTFNFDPEPEESEEKSPVKGGERAHHEDQEGEEGTQAQERAKKTE
EEELLNGKDAEDFLLGLDPTAHDFVAVRAAEYKSARIQLQKEKEILFTPSRLTVPTYKKL
PENIQPRFLEDEGLYIGARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPF
PSRPSLTTREQSPKAGLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPC
FSREHVLASKLAQLYDQYLARQQRNKTKFLTDKLQALRKAVQTSLNPEKPHQSLDTTQKT
INEYKSEIRQTRKLRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVD
PKLDEDAYEAEIQAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQRAKKKKKKQTTE
EHLEEEEAEESFPEEEVTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPTLIPELSLAGN
VTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVHFGQIFNLQIFN
WPESLMLQVYETIGHSGTTLLAEVFLPIPETTLVTGRAPIEEVEFSSNQHVTLDHEGVGS
GVPFSFEADGSNQLTLMTSGKVSHSVAWAVGENGIPLIPPLSQQNIGFRSALRRADAISS
IGTSGLTDMKKLAKWAAESKLDPNDPNHAPLMQLISVATSGESYVPDFFRLEQLQQEFNF
VSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQDYEKRLRDRNVIETKD
HLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPNISSEGSGILGLSLFKL
AEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSKFQQPSRSSRTFS
EKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPNPSWNEELELPFRA
PNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIERHWLGCVKIPFSTIY
FQARIDGTFKIDIPPVLLGYSKERNIIMERAFDSARSLSEGSYITLFITIEPQLVPGEPM
REKMSDMLKKFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTVFITRYLKPL
NPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQFLDLLAGDEEE
HAVLLCNYFLFLGKKAWLVMGSAIPEGPTAYVLTWEKNYYLIWNPCSGHCYGQFDAFCPL
KSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGLSSVQPEELIYQH
TDKAVAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLERSQGEDIEDDHR
AELLKQLGDYRFSGFPLHMPYSEVKPLVEAVYSTGVHNIDLPNVEFALAVYIHPYPKNVL
SVWIYVASLVRNR
NT seq 4902 nt   +upstreamnt  +downstreamnt
atgaataccaacgacgaaaaaatgaaaataatttcagaggacttcactggagatggtgtg
gacacagaggcgggaagacggaagaagaattcaaaggtgcgaagacagcagagaaagaaa
aagccacccgcctctccccctgaggaaatggtgtcagacaaattccaagatggtgggcag
caggaagtggtggaggaagagcccgagaccaacctcctgagcttgacagcccggcggggg
ccccggagcttacctcccatcccttcagcttctagaaccggctttgcagaattttccatg
agggaacgaatgagggagaaacttcaggctgcaaggtccaaggcagaaagcgcattgttg
cgggatgtccccacccctagacccaggcgcctgcgcagtccctccagagagaaggaaaca
gagactgaatttggcacagagccaagtacagaggtgcaagacactcaaaaagaagacgac
acaaagagttattcaagaattaagttccgtgattctgtacgaaaaattaagtcaaaaccc
cagctccctcctggtttcccatctgcagaagaggcctataatttctttacgttcaacttt
gatcctgagccagaggaatcagaggaaaaatcaccagtaaaaggtggagagagagctcat
catgaggaccaagaaggagaagaaggaacacaagctcaagagagagcgaagaaaacggaa
gaggaagagctgcttaatgggaaggatgctgaagacttcctgttgggcttagatcccacg
gcccatgacttcgtggcagtcagagctgcagagtacaagagtgcccgcattcagctgcag
aaggagaaagaaatcctcttcacgcctagtcggctgacagtgccgacctataaaaagctt
cctgagaacatacagccaagattcctggaagatgaaggtctttacatcggggccagacca
gaggtggcacgcaccaatgagaacatcatggagaaccgactgctgatacaggagcctggg
agtaagtggttcggagatgatggcagaatcctggcactgcccagccccatcaagccgttt
ccctcaaggccatcactaaccacacgggagcaaagccccaaggctggactggagactttg
tacaagaaggcagagaagtatgtccacagtagacagcatatgattggatctggagaccct
ccaggaaatttccaactggacatcgatatttctggcttaatcttcactcatcacccctgt
tttagccgagagcatgtcttggcatcaaagctggcccagttgtatgaccagtaccttgca
agacagcaaagaaataagacgaaattccttacagataagcttcaagcactaagaaaagct
gttcagaccagtcttaacccagagaaacctcatcagtctcttgacacaacccagaaaacc
atcaatgagtataaatctgaaattcggcagactcgaaaactgcgagatgctgaacaagag
aaagatcgaacactgctgaagaccatcataaaggtctggaaagagatgaagtcattacgg
gagttccagaggtttacaaacacgccgttgaagctcgtcttgagaaaggaaaaagttgac
ccgaaactagatgaggatgcatatgaagccgagattcaagctgagatccatgaactgctg
gaggaacacatggaggaatatgcaacaaagatggaagagtacagaacatctcatcagcaa
tggaaagcctggaggaaagcccagagggccaaaaagaagaaaaagaagcaaacaacagag
gaacacctcgaggaggaagaggctgaggagtccttccctgaggaagaggttactaagccc
attcccccagagcccactgacccagctgtcatagagcagcaggtgcgggagagagcagcc
cacagcaggaggaggccaggggagcccacactcattccagagttgagtctggcagggaat
gtgacccccaatgaccagtgtcctagggtggaggtctccagaagggaagatgtcaggagg
cgctctgtatacttaaaggtggtcttcaacagcaaagaggtgtcgaggactgttagccgg
cctctaggggcagatttccgggttcactttggacagattttcaacctgcagatattcaac
tggccagagagcttaatgcttcaggtctatgaaactattggtcatagtggtaccaccttg
ctagctgaggtcttcctgcctatccctgagacgacccttgtcacgggaagggcccccatt
gaagaggtggagttcagcagtaaccagcatgtgacattagaccatgagggagttggaagt
ggggtgcccttctccttcgaagctgatggcagcaatcaactgactctaatgacatcaggg
aaagtgtcccacagtgtggcatgggccgttggggaaaatgggattcctttaattcctcca
ctgtcacagcagaacattggatttcgaagtgctttgaggagggcagatgccatctcatcc
attggcacatcagggctgacggacatgaagaagttggccaagtgggcagcagagtccaag
cttgaccccaatgatcccaaccacgccccattgatgcagctgatctcggttgctaccagt
ggtgaatcctatgtccctgacttcttccggctggagcagctgcagcaggaattcaacttc
gtctcagaggaggaattaaatagatccaaacggttccgacttctccatcttaggagccaa
gaggtgccagaattccggaactataaacaaattccagcatatgaccgagaaattatggaa
aaggtattccaggactatgagaaacgattacgagacagaaatgtaattgaaaccaaggac
cacctggacatgcacagagccacagtagccaagtaccttcagcaagttagagaagcagtg
gtaaatcgcttcctaactgccaaacaccattttcttcttactgatttggtagtagaagaa
gaagtccccaatatcagttctgaaggctcgggcattttgggcctaagccttttcaagctg
gcagaacaaaagcgaccactgaggccacggaggaaaggtcggaagaaggtgacagcccaa
aacctgtctgatggagacataaagctgctggtgaacattatccgggcttacgacatccct
gtaaggaaacctgtagtgagcaagtttcagcagccatcgagatcttcaagaactttcagt
gaaaagcaaactgcttcccccagcacacacagcccactacacaacgctgactaccccctc
ggccaggtcttagtccggccttttgtggaggtctcttttcaaagaacaatttgccacaca
accacagctgaaggaccaaatcccagctggaacgaagaacttgaacttccgttcagggcc
cccaatggggactacagcacagccagcttacagtcagtgaaggatgacgtatacattaac
atttttgatgaagtgctgtatgatatcctagaggatgaccgtgaaagaggaagtgggatc
catacgcgtattgagagacactggttaggatgtgtgaaaatcccatttagcaccatctat
ttccaggcaaggattgatggcacatttaaaatagacattcctccagttctcctgggctat
agtaaggagcgaaacattattatggaacgagcctttgattctgcccgaagcttgagtgaa
ggctcctacatcaccctgtttattaccattgagcctcagctggttcctggggagcctatg
agagaaaagatgagtgacatgcttaagaagtttgatacccaggaagatgagaaattactt
caagcaacagagaaatttcaagctgaatgtgccttaaaattcccccagcgtcagtgcctc
accacagtgactgacatgaccgggaaaacggtttttattacgcgttatctcaagccttta
aaccctccgcaggagctccttcacgtctaccccaacaacccgcaggccactgcggagctg
gtagctcggtatgtgtccttgatccctttcttgcctgatagcgtgtcgtttgctggagtc
tgtgacctgtggagcacttctgatcaattccttgacctcctggcgggtgatgaagaagag
catgcagtactgctatgcaattactttctgttcctgggtaagaaggcatggctggtgatg
ggcagtgcgattcctgagggtccaactgcctatgtgctaacttgggagaaaaattattat
ttaatatggaatccctgcagcggacattgttacggacaatttgatgcattttgccctttg
aaaagtgtgggctgtttaattggtcctgataatatttggtttaatattcaacaccatgat
tctccactaaggataaattttgatgtcacaaagcccaaactatggaaatcttttttttca
cgaagtcttccatatcctggcctatccagtgttcagccggaagagctaatttatcaacac
acagacaaagcagtagctgctgaactgcaagacaggattgaaaaaatactaaaagaaaaa
atcatggactggaggccacgccacctgaccaggtggaacaggtactgtacctccaccctg
cgccacttcttgcctctactggaaagaagtcaaggagaagatatagaagacgaccacagg
gcagagctgttgaagcagctgggggactacaggttctctggatttcctcttcacatgcct
tattctgaagtgaagcctttggttgaagcggtgtatagcactggagtacataacattgac
cttcctaatgttgagtttgctttagctgtatacatacacccttatcccaaaaacgttttg
tctgtttggatctatgttgcttctcttgtacggaacaggtaa

DBGET integrated database retrieval system