KEGG   Mus musculus (mouse): 231225Help
Entry
231225            CDS       T01002                                 

Gene name
Tapt1, 4932414K18Rik
Definition
(RefSeq) transmembrane anterior posterior transformation 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF747 DASH_Dad4
Motif
Other DBs
NCBI-GeneID: 231225
NCBI-ProteinID: NP_776125
MGI: 2683537
Ensembl: ENSMUSG00000046985
Vega: OTTMUSG00000053809
UniProt: Q4VBD2
Position
5; 5 B3
AA seq 564 aa AA seqDB search
MAGVCDAAAPGEGGGGGADGPERTGRGEAEQPGGGGHGPAPQHTETLGFYESDRRREKRR
GRAELSLLRFLSAELTRGYFLEHNEAKYTERRERVYTCMRIPRELEKLMFFGIFLCLDAF
LYVFTLLPLRVFLALFRLLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDYSM
MYHLIRGQSVIKLYIIYNMLEVADRLFSSFGQDILDALYWTATEPKERKRAHIGVIPHFF
MAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMS
NSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKF
NDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSSIKV
QGILSYACVILFYFGLISLKILNSIVLLGKSCQYVKEAKMEEKLFNPPPASTPGKPSSKS
QSKGKPSQGLSTEENLSASVTSQPGHQKENVIPLLVTSNSDQFLTTPDGDEKDITQENSE
LKHRSSKKDLLEIDRFTICGNRID
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtctgcgacgcggccgccccgggagaaggcggcggtggcggcgcggacggc
cccgagcggaccggccgcggcgaggcggagcagccgggtggtggcggccatgggcccgcg
ccccaacacaccgagacgctgggcttctacgagagcgaccggcggcgggagaagcgccgc
ggccgcgcagaactgtcattattgaggttcctcagtgctgaactgacaagagggtacttc
cttgaacataatgaagccaagtatacagagcgaagagaaagggtgtacacttgtatgcga
ataccaagagaattggaaaagctcatgttctttggaatatttttgtgcctcgatgccttt
ctgtatgtgttcaccctgcttcctttaagagtctttctggcgctattcaggctcctcact
ctgccttgctatggcttaagggaccgacgtctgcttcagcccgcacaggtgtgtgacatt
ttgaagggcgtcatcttggtaatctgctatttcatgatgcactatgttgactactccatg
atgtaccacctgataagaggccagtctgtcatcaagctctatatcatctacaacatgcta
gaggtagctgatcgtctgttctcctcgtttggacaagatatcttagatgctctctactgg
acagccacagagccgaaagaaaggaaaagagcacacattggagtcattcctcacttcttc
atggctgttctctatgtctttctacatgcaattcttatcatggttcaagcaacaactctc
aatgtagcttttaactctcacaacaagtcactgcttactatcatgatgtctaataatttt
gttgaaattaaaggaagtgtattcaagaagtttgaaaagaataatctctttcagatgtca
aatagtgatattaaggagcgattcacaaattacgtgcttttgttaatagtgtgcttaaga
aacatggagcagttttcttggaatccagatcatctctgggtgttgtttcctgacgtctgt
atggtgattgcatccgaaattgctgtggatattgtaaagcatgcctttatcaccaaattc
aatgacatcactgcagatgtctacagtgaatatagagccagccttgcttttgaccttgtt
agcagccgacagaaaaatgcatacacagactacagtgactcggtggcacggaggatgggg
tttattcctctcccgctagctgtcttactcatcagagttgtaacaagctcaattaaagtg
caaggaatcctgtcctacgcctgtgtcatactcttctattttgggttgatctccttgaaa
atacttaatagcattgtgctgttgggaaagtcctgtcaatacgtgaaggaagccaaaatg
gaagagaagctatttaatcctcctccagccagcacacccggaaaaccctccagcaaatcc
cagagcaagggcaagccctctcaaggcctttccacagaagaaaacctgtctgcctccgtc
accagccagcctggtcatcagaaagaaaacgtcatacctttactcgtgactagcaattct
gatcagttcctgacaaccccagatggtgatgagaaggacataacacaggaaaattctgag
ttaaagcacagatcctcaaagaaagacttgttagaaatagacaggttcacaatttgcggg
aaccggattgactga

DBGET integrated database retrieval system