KEGG   Mus musculus (mouse): 231238
Entry
231238            CDS       T01002                                 

Gene name
Sel1l3, 2310045A20Rik, AI429585, mKIAA0746
Definition
(RefSeq) sel-1 suppressor of lin-12-like 3 (C. elegans)
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Sel1
Other DBs
NCBI-GeneID: 231238
NCBI-ProteinID: NP_766298
MGI: 1916941
Ensembl: ENSMUSG00000029189
Vega: OTTMUSG00000054611
UniProt: Q80TS8
Position
5; 5 C1
AA seq 1137 aa
MQWRGAGLWWPRRRQQQQQQQPPPPAFGPPAAAMVPPSRGVSPGLGGRPTSALLFLCYLN
FVPSLGRQTSLTTSVLPRTEQSTTYADFIYFTAFEGSVRNVSEVSVEYLCSQPCVVHLEA
VVSSEFRSSIPVYKKRWRNEKHLHTSRTQTVHVKFPSIMVYRDDYLIRHPISVSTVILRA
WITHWHSGGGLNVRGEENLLHAVAKNYTLLQTVPPFERPFKDHQVCLEWNMDYLWSLWAN
RIPQCPLESDAVALLSFPYASSGENTGIVKKLQNFQNRELEATRSQRVDYPMVTISLWLY
LLHYCEASLCGILYFVDSNEMYGTPSVFLTEDGSLHIQMHLVKGEDLAVKTKFTIPLKEW
CRLDISFNGGQIVVTASIGWDLKSYHNQTISFHEDFYYNDTAGYFIIGGSRYVAGIEGFF
GPVKYYRLRSLHPAQVLNPFLEKELAEQIKLYYERCTEVQDIISSYAATVQVGGERRETC
DFHNSYLDLKRKYGRAEVCRGLPWEKELRDRHPSLFQSLLQMDLLTVPWNQNDSVLEIGA
RIFEKAVKRLSGVDGLHQISSAIPFLMDSSCCGYHKASYYLTVFYETGLNGPRDQLQGML
YSLVGGQGSERLSSMNLGYKHYQGVDSYPLDWELSYAYYSNIATKTPLDQHTLQGDQAYV
ETIRLKDDEILKVQTKEDGDVFMWLKHEATRGNAAAQQRLAQMLFWGQQGVAKNPEAAIE
WYAKGALETEDPALIYDYAIVLFKGQGVKKNRRLALELMKKAASKGLHQAVNGLGWYYHK
FRKNYAKAAKYWLKAEEMGNPDASYNLGVLYLDGIFPGVPGRNLTLAGEYFHKAAQGGHI
EGTLWCSLYYITGNLETFPRDPEKAVVWAKHVAEKNGYLGHVIRKGLNAYLEGLWHEALL
YYVLAAETGIEVSQTNLAHICEERPDLAGRYLGVNCVWRYYNFSVFQIDAPSFAYLKMGD
LYYYGHQNQSQDLELSVQMYAQAALDGDSQGFFNLAALIEEGAVIPHHILEFLEIDPSLH
SSNTSILQELYERCWSLSNEESLSPCSLAWLYLHLRLLWGAVLHSALIYFLGTFLLSVVI
AWMVLYLQYISASGSSPAPAWVSADPTSSTPSPAVPPAADASDHDPPMMANGPEPRG
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgcagtggcgcggcgcggggctttggtggccacggcggcgacagcagcagcagcagcag
cagcccccgccgcccgctttcggtcccccggccgcagccatggtccccccgagccgcggt
gtctccccgggcctcggcggccgccctaccagcgcattgctctttctctgctacctgaat
tttgtgccatcgttgggcaggcagacttccctgacgacatcagtgctgcccaggacagaa
cagagcacaacgtatgcagactttatttattttactgcctttgaagggagcgtgcgcaat
gtctctgaagtctccgtggagtatttatgctctcagccttgtgttgtccatttggaggcg
gttgtctcctccgagttcagaagcagcatccccgtgtacaagaagaggtggaggaatgag
aagcatcttcacaccagcaggacgcagacagtgcacgtgaagttcccgagcatcatggtg
tacagggatgactatttgatcagacaccccatctcggtgtccacggtgattctccgagcc
tggattactcactggcacagcggcgggggcttgaacgtccgaggggaggagaatttgctg
cacgcagtagcgaagaattacaccctgctgcagacggtcccgccttttgaacggcctttc
aaagatcatcaggtgtgcctggagtggaacatggactatctctggagcctctgggccaat
aggatcccacagtgtcctctggaaagtgatgcagttgccctcctcagcttcccctatgct
tccagcggagaaaacacaggcatcgtgaagaagctccaaaatttccagaacagagagcta
gaggccactcgaagccagcgcgtggactaccccatggtcaccatttcactgtggctttat
ttactccattattgcgaggccagcctctgtggaattctgtactttgttgattctaatgag
atgtacggcacgccttctgtgtttcttacggaagacggcagtttgcacattcaaatgcat
ctcgtcaaaggagaagacctggctgtaaaaaccaagttcaccatcccattgaaggagtgg
tgccgactggatatctcgttcaatggaggccagatagtggtcactgccagcattggatgg
gacttgaaaagctaccataatcagaccattagcttccatgaagacttctattataacgac
acagctggctacttcattattggagggagcaggtacgtggccggcatcgaagggtttttt
ggaccggtgaaatactatcgcctccgcagcctacacccggcacaggttcttaatcccttc
cttgagaaggaactggctgaacaaatcaagctatactatgagcggtgtactgaggtccag
gatataatatcctcgtatgctgcaacagtccaggttgggggtgagaggcgagagacatgt
gacttccataactcctacctggacctcaagcgcaagtatgggagagccgaggtgtgcaga
ggcttgccctgggagaaggaactgagagacaggcaccccagcttgttccagagcctgctg
caaatggacctgctgaccgtgccatggaaccaaaatgactccgtattagaaatcggtgca
aggatatttgagaaggctgtaaagagactctctggcgttgatggccttcaccaaattagc
tctgccatcccctttctgatggattccagctgctgtggataccataaagcatcctactac
ctcaccgtcttctatgaaactggattaaatggacctcgggatcagctgcagggcatgcta
tacagtctggttggaggccagggcagtgagagactgtcatcaatgaatcttgggtacaaa
cactaccagggtgttgacagctacccactggactgggaactgtcctatgcctactacagc
aacattgctacaaagacaccccttgatcagcacacactgcagggagaccaggcatatgtt
gaaactattaggctcaaagatgatgaaatactcaaagtccaaaccaaagaagatggcgat
gtctttatgtggctgaagcacgaagccacccgtggcaacgcagcagcacagcaacgattg
gctcagatgctcttctggggacagcaaggggtggccaagaaccctgaggccgctatcgag
tggtacgcgaagggggccctggagacggaggatccggcgctgatatatgactacgccatt
gtgctattcaagggtcaaggagttaaaaagaacagacggctcgccttagagctcatgaag
aaagctgcttccaagggattgcatcaggctgtcaatggcctgggatggtattaccacaaa
ttcaggaaaaattatgccaaagcagccaagtactggttaaaggcagaagaaatggggaac
ccagatgcgtcttacaatcttggggtcctgtatttggatggcattttcccgggagttcct
ggaaggaatctgacactggctggtgaatacttccataaagctgcacaaggtggacacatc
gaagggacattgtggtgttccctttactatatcaccggcaacctggagaccttccctaga
gatccagagaaagctgttgtatgggcaaagcatgtggccgaaaaaaacggatacctggga
cacgtcatccgcaaaggtctcaacgcctacctggagggcctgtggcacgaagctttgctg
tattatgttttagcagcagaaactggaattgaagtgtcacagacaaatttagcacacatc
tgcgaggagaggccagacctggctgggagatacttgggcgttaattgtgtttggcgatac
tataatttctctgtttttcaaatcgatgctccttcatttgcgtatctgaaaatgggagac
ctttactactatggccatcaaaaccagtcccaagatctggagctgtctgtgcagatgtac
gcccaagcagccctggatggagactcccagggatttttcaacctcgccgcactgatagag
gaaggtgctgtcatcccacaccacatcctggagttcttggaaatcgacccttcactccat
tccagtaacacctccatactccaggagctctacgaaaggtgctggagtctcagtaatgag
gagtcccttagcccctgctccttggcctggctttaccttcatcttcggcttctctggggt
gccgttctgcactctgccctgatctacttcctgggaaccttcctgctttccgtggtgatc
gcctggatggtgctttatctccagtatatctcagccagtggctcctctccagcaccagcc
tgggtctcggcagaccccacctcatccaccccaagtccagctgtgcctccggctgcagat
gcctccgaccacgacccacccatgatggctaacggccctgagcctcgtgggtga

DBGET integrated database retrieval system