KEGG   Mus musculus (mouse): 231252
Entry
231252            CDS       T01002                                 

Gene name
Chrna9, 2410015I05Rik, Acra9, EG666827, Gm8311
Definition
(RefSeq) cholinergic receptor, nicotinic, alpha polypeptide 9
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    231252 (Chrna9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    231252 (Chrna9)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   231252 (Chrna9)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5665
Other DBs
NCBI-GeneID: 231252
NCBI-ProteinID: NP_001074573
MGI: 1202403
Ensembl: ENSMUSG00000029205
Vega: OTTMUSG00000022200
UniProt: G3X8Z7
Position
5 C3.1; 5 33.84 cM
AA seq 479 aa
MNRPHPCISFCWMYFAASGIKAVETANGKYAQKLFSDLFEDYSNALRPVEDTDAVLNVTL
QVTLSQIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVQGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLS
PRHSQEPEQITKVYGKLPGSNLKASRNKDLSRKKELRKLLKNDLGYQGGIPQNTDSYCAR
YEALTKNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFAMVFVMTVLIIARAD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaaccggccccatccctgcatctccttttgctggatgtattttgctgcttctggaatc
aaagccgtagagacagcaaatggaaagtatgcccagaaattgtttagcgatctttttgaa
gactactccaatgctctgcgtccagtagaagatacggacgcggtgctgaacgtcactctg
caggtcacgctctcccagataaaggacatggacgagagaaatcagattctgacagcctac
ctgtggatccgccaaacttggcacgatgcgtacctcacgtgggatcgagaccagtatgac
gggctggactccatcaggattcccagcgatctggtgtggaggccggacattgtcctctac
aacaaggccgatgacgagtcttcagagccggtgaacaccaacgtggtcctgcggtacgat
gggctcatcacctgggactcaccagccatcaccaaaagctcctgtgtggtggatgtcacc
tatttccccttcgacagccagcagtgcaacctgacctttggttcctggacctacaatggg
aaccaggtggacatattcaatgccctggacagtggtgacctctctgacttcattgaagac
gtggaatgggaggttcagggcatgcctgccgtgaagaacgtcatctcctacggctgctgc
tcggagccttacccagacgtcaccttcactctccttctgaagaggaggtcttccttttac
attgtcaacctcctcatcccttgcgtcctcatatcgttcctcgctccgctgagtttctac
ctcccagcagcctccggggagaaggtctctctgggagtgaccatcctattggccatgact
gtatttcagctaatggtggcagagatcatgccagcctcagaaaacgtccctctgatagga
aaatactacatagctaccatggccttgatcaccgcctccacagcccttaccatcatggtg
atgaatatccacttctgtggggcggaagcccggccagtaccacactgggccaaggtggtc
atcctgaaatacatgtccaggatcttgtttgtctacgatgtgggtgagagctgccttagc
ccccgtcacagccaggagccagaacaaatcacgaaggtttatggcaaacttccagggtcc
aacctgaaagcatccagaaacaaagacctttccagaaagaaggaactgagaaaactccta
aagaatgacctagggtaccagggtgggatcccccagaatactgacagctactgtgcacgc
tatgaagcactgacaaaaaatattgaatacattgccaaatgtctcaaggaccacaaggcc
accaactccaagggcagcgagtggaagaaggtcgccaaggtcatagaccgtttcttcatg
tggattttcttcgctatggtgtttgtcatgaccgtcttgatcatagcaagagcagattag

DBGET integrated database retrieval system