KEGG   Mus musculus (mouse): 231287
Entry
231287            CDS       T01002                                 

Gene name
Atp10d, 9830145H18Rik, ATPVD, D5Buc24e
Definition
(RefSeq) ATPase, class V, type 10D
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    231287 (Atp10d)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     231287 (Atp10d)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3 Vpu
Other DBs
NCBI-GeneID: 231287
NCBI-ProteinID: NP_700438
MGI: 2450125
Ensembl: ENSMUSG00000046808
Vega: OTTMUSG00000022559
UniProt: Q8K2X1
Position
5; 5 C3.2
AA seq 1469 aa
MTNGWLGSVTLPALWISAPFSFGTLGSEVTPCWDERPGRDRSPEPAGSPCVLGMTELLQW
ARHHWRRLSHGRAQGEDERPYNYASLLACGGKSSRTPRPAGKHRVVIPHLQCFKDEYERF
SGTYVNNRIRTTKYTLLNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQKEITMLPL
VVVLTIIAIKDGLEDYRKYKIDKQINNLITKVYSRKEKKYIDCCWKNVTVGDFIRLSCNE
IIPADMVLLFSTDPDGICHIETSGLDGESNLKQRQVVRGYTEQDSEVDPEKFSSRIECES
PNNDLSRFRGFLEHANKERVGLSKENLLLRGCTIRNTEAVVGIVVYAGHETKAMLNNSGP
RYKRSKLERRANTDVLWCVLLLIVMCLTGALGHGIWLSRYENMLFFNIPEPDGRVISPVL
TGFYVFWTMIILLQVLIPISLYVSIEIVKLGQIYFIQSDVDFYNEKMDSTIQCRALNITE
DLGQIQYLFSDKTGTLTENKMVFRRCSVAGFDYCHEENAKRLESYQEAVSEEEECTDTLG
GSLSNMARPRAQGCRTVPSGPLGKPSAQLSGSTSAVGNGEGSGEVPHSRQAAFSSPMETD
VVPDTRLLDKFSQLTPQLLTGLDGTAQSSPLETLYIMDFFIALAICNTVVVSAPNQPRQK
IGLSSLGGMPIKSLEEIKNIFQKLSVRRSSSPSLASGKDSSSGTPCAFVSRISFFSRPKL
SPPMEDESSQMDEIPQASNSACCTETEAQNRAVGLSVSSAEALSGPPPSASNLCYEAESP
DEAALVYAARAYRCTLQSRTPEQVMVDFAALGSLTFQLLHILPFDSVRKRMSVVVRHPLS
KQVVVYTKGADSVIMELLSVAASDGTNPEQQMIIRERTQRHLDEYAKRGLRTLCVAKKVM
SDTEYAEWLRNHFLAETSIDNREELLVESAMRLENKLTLLGATGIEDRLQEGVPESIEAL
HQAGIKIWMLTGDKQETAVNIAYACKLLEPDDKLFILNTQSQDACGMLMSAILEELQKRA
QVSPELASSRKNFPQPSDAQGQGRAGLVITGKTLEFALQESLQRQFLELTAWCQAVICCR
ATPLQKSEVVKLVRNHHHVLTLPIGDGANDVSMIQVADIGIGVSGQEGMQAVMASDFAIS
QFRHLSKLLLVHGHWCYTRLSNMILYFFYKNVAYVNLLFWYQFFCGFSGTSMTDYWVLIF
FNLLFTSVPPIIYGVLEKDVSAETLLQLPELYRSGQRSEEYLPLTFWITLLDAFYQSLVC
FFVPYFTYQGSDIDIFTFGNPLNTAALFIILLHLVIESKSLTWIHMLVTVGSILSYFFFA
LAFGALCVTCNPPSNPYGIMRKHMLDPVFYLVCVLTTFVALLPRFLYRVLQGSVFPSPVL
RAKYFDRLPPEERAEALKRWRGTAKVNHVASKHASQSAAMSGRPTPGSSAVLAMKSATVS
TVEQSTRETALDRGCSEPGASKMTGSSAS
NT seq 4410 nt   +upstreamnt  +downstreamnt
atgacaaatggctggcttggaagcgtaactctccccgccctttggatctctgctccgttc
tcttttggcactttgggatccgaggtaacaccatgctgggatgagcggcccgggagggac
agatcgcctgagccagccgggtctccctgcgtcttgggcatgactgagctgctgcagtgg
gccagacatcactggcgtcggctgagccatgggagagcccagggtgaagatgagaggcca
tacaactacgcctccctgctggcctgtgggggcaagtcctcgaggacccccagacctgca
ggaaagcaccgcgtcgttattccccaccttcagtgcttcaaagatgagtacgaaaggttt
tctggaacctacgtgaataaccggatacggacgaccaagtacacactcctgaactttgtg
ccaagaaacttatttgaacagtttcacagggctgccaatttatatttcctgttcctcgtg
gtcctgaactgggtgcctttggtagaagccttccaaaaggaaatcaccatgctgcctctg
gtggtggtcctcacaattattgcaattaaagatggcttggaagactaccggaaatacaaa
atcgacaagcagatcaacaacttaataaccaaagtttacagtaggaaagaaaaaaagtac
attgactgttgctggaaaaatgtcaccgtcggggacttcatccgcctgtcctgcaatgag
atcatccctgcagacatggtcttactcttttccacagacccagatggcatctgccacatt
gagacttccggccttgatggagagagcaatttaaagcagaggcaggtggtgcgtggctac
acagagcaggactctgaggttgatccggagaagttctccagcaggatagaatgtgaaagt
ccaaacaatgacctcagccgattccgaggcttcctggaacatgccaataaagaacgtgtg
ggcctcagcaaagagaatttattgctccgcgggtgcaccatcagaaacacagaggctgtg
gtgggcattgtggtctatgcaggtcatgaaaccaaagcaatgctgaacaacagtgggcca
cggtataagcgcagtaagttagagagaagagcaaacaccgacgtcctctggtgtgtcctg
cttctgattgtcatgtgcttaactggtgcactgggtcacggcatatggctgagcaggtat
gagaacatgctcttttttaacatccctgagccggatggacgtgtcatctcacccgtgctg
actggattctatgtgttctggaccatgatcatcttgctgcaggtcctgatccccatttct
ctctatgtgtccattgagatcgtgaagcttgggcagatctatttcatccagagcgatgta
gatttctacaacgagaaaatggattctaccattcagtgccgagccctgaacatcactgag
gaccttgggcagattcaatacctcttttctgataagacaggaaccctcactgagaataag
atggtgtttcggaggtgcagtgtagcagggtttgactactgtcatgaagaaaacgccaag
aggctcgagtcctatcaggaagctgtctctgaagaggaggaatgcacagacactctcggc
ggctccctcagcaacatggcgagacccagagcccagggctgcaggacagttcccagtggg
cctctgggaaagccctcggctcagctctccgggagcacctctgctgtaggaaatggagaa
ggatctggggaagtgcctcattccagacaggccgccttcagtagtcccatggaaacagac
gtggtaccagataccagacttttagacaaatttagccagcttacccctcagctgctcact
ggactggatggcaccgctcagagttcaccgctggagactttgtacatcatggacttcttt
attgcactggcaatttgcaacacggtggtggtttctgcaccgaaccaacctcggcaaaag
attggactctcctcactgggtggaatgcccatcaagtccttggaagagattaaaaacatc
ttccagaaattgtccgtccggagatcaagttcaccgtcccttgccagtgggaaggattca
tcctctgggactccctgtgcctttgtgagcagaatctctttctttagtcgaccaaaactg
tcacctcctatggaggacgagtcttcccaaatggatgaaatcccccaggccagtaactca
gcttgctgtacagaaacagaggcacaaaacagggccgtaggactcagtgtcagttccgct
gaagccctaagtggaccaccgccctcggcttccaacctgtgctatgaggcggagagtcca
gatgaagcagctttggtgtatgccgccagagcttaccgttgcactttacagtctcggacc
ccagagcaggtcatggtggactttgctgctttgggctcattaacatttcaactcctacac
attctgccctttgactctgtaaggaaaagaatgtcggtcgtggtcaggcatcctctttcc
aaacaagtcgtggtgtatacaaaaggcgctgattctgttatcatggagctgctgtctgtg
gctgcctcagatggaacaaatccagaacaacagatgataataagggagagaacgcagagg
cacctggacgagtatgccaaacgagggctgcgcactctatgtgtagcaaagaaggtcatg
agtgacacggaatatgcagagtggctgaggaatcactttctagctgaaaccagcattgac
aacagggaggaactgctagttgaatctgccatgagactagaaaacaaactcacgttactt
ggtgctactggcattgaggatcgtctgcaggagggggtccctgagtctatagaagccctt
caccaagctggcatcaagatctggatgctgacaggggacaagcaggagacagctgtcaac
atagcttatgcatgcaaactcctggagccagatgacaagctcttcatcctcaatacacag
agtcaggatgcctgtgggatgctgatgagtgcaattttggaagaacttcagaagagagct
caagtgtctccggagctggcatcatcaagaaagaactttcctcagccctctgacgctcag
ggccagggacgtgcgggacttgttatcactgggaagaccctggagtttgccctgcaggag
agtctgcaaaggcagttccttgagctgaccgcgtggtgccaagctgtgatctgctgccga
gccaccccccttcaaaaaagtgaggtggtgaaattggttcgaaaccatcaccatgtgctg
accctacccattggtgacggtgccaatgatgttagcatgatacaagtggccgacattggg
atcggtgtctcaggtcaagaaggcatgcaggctgtgatggccagtgactttgccatctcc
cagttcagacatctcagcaaacttctccttgtgcacgggcactggtgttacacccggctc
tccaacatgattctctattttttctacaagaatgtggcctatgtgaatctccttttctgg
taccagttcttttgtgggttttcaggaacatctatgacagactactgggtgctgatcttc
ttcaacctcctcttcacatctgtaccccccatcatttatggcgttttggagaaagatgtt
tcggcagagaccctcctgcagctgcctgaactttaccggagcggtcagcgatcagaggag
tacttgcccctcaccttctggatcaccttgttggatgccttttatcaaagcctggtctgc
ttcttcgtgccttactttacctaccagggctctgacattgacatcttcacctttgggaat
cccctgaacacggcggctctgttcatcattctcctccacctggtgattgaaagcaagagt
ttgacttggatccacatgctggtcacggttgggagcatcttgtcctactttttctttgcc
ttggcttttggagccttatgtgtcacttgcaacccaccctccaacccctacgggatcatg
cggaagcacatgctggaccctgtgttctacttggtttgtgtacttacaaccttcgtcgcg
ctcctgccgaggtttctttaccgagttcttcagggatccgtgtttccatctccagttctc
agagccaagtactttgacagactacctccagaggagagagctgaagctctcaagaggtgg
agagggacagcaaaggtcaatcacgtggcatctaagcatgccagccaatcagctgctatg
tcaggaagaccaacacctgggtcttctgctgtccttgcaatgaagtcagcaacagtgtct
actgttgagcagagcacacgtgagactgcgctagaccgtggctgctctgaacctggggcc
tccaagatgactggatcctcagcaagctaa

DBGET integrated database retrieval system