KEGG   Mus musculus (mouse): 231296
Entry
231296            CDS       T01002                                 

Symbol
Lrrc66
Name
(RefSeq) leucine rich repeat containing 66
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRR_9
Other DBs
NCBI-GeneID: 231296
NCBI-ProteinID: NP_705796
MGI: 2387634
Ensembl: ENSMUSG00000067206
Vega: OTTMUSG00000026766
UniProt: Q8K0B3
Position
5; 5 C3.3
AA seq 872 aa
MRDFYVRVTILVTGLCFVETVTTPSRKSSVSFNPEYQRNGDLLVNWSSIRHVSQNTDAMD
RSFYFFRVLFQPHTQKERHIKPPDRTHHRISKVTLDPLAHLHALEILNLSNKAIHYFSLD
QPLPPSSHQKRHGGHSHSRLPRLQVLILQRNQLSGTPKGLWKLKSLRSLDLSFNRIVHIG
LSDFHGCLQLESIYLKSNKICTIHPKAFKGLKKLQVVDLRSNALTTLVPIVTIALELPHL
ELGLADNQWQCSESNVNFQNITSSSWREIWKAICNMSVENKRPNAETHQIRKSRDTHLLL
SPPSDLKSLIQSKAERPQAGMDMHLSALGKEAKDGYGDLRGMWPQSPVELRDSQDEQVTD
RKDDKPPALELAICLSVFITFVVAFCLGAFARPYIDRLRQQRCSNKRPGSDNAYSNKGFH
GDIEGAQHMEYQGTDLHQTTHHLHLSENQNPSWVAEPIPHSAVQSEQMLGSNGTDPGHQQ
SPEQLKDSNESRSGDSIVLPSGPVAHLALHGLPNADAHKAISPVQHHHDFLEEAHYDTVA
QEYSLIDDVMDRSSITGPLGTFPSSVESRRDDLHPSQPRDVVASFSKTLAHANTREAEGS
METGCPEPLGAMDSQMGSSEERQVSNSIRELATQQPSFQGVDAEERLSHVYSEVLHNDPP
SLRPRWGSGHYVIPATGEPVERDAPFDPHYDLVTNYESDSDEGSLFTLSSEGSEDTRSLA
EEQASVENDGTSQPLPSRNLGEYKDSVTSAESVEDLTSQRIPEKCEAQEAHLRNTLISGP
DSCVCETNQENDSSSLDPENRSTWPQLPGHKLSHHETLGTYGDIEPQSEAVDWHYSLRDL
ESPNVDSSPSPPYSDEDLSGPEDRARKRSKHW
NT seq 2619 nt   +upstreamnt  +downstreamnt
atgagagacttctacgtcagagttactatcctagttacaggtctttgctttgtggaaaca
gtgacaaccccatcaagaaaaagcagcgtttccttcaatcccgagtaccagaggaatggg
gaccttctggtaaactggtcttctataagacacgtgtcacagaacacagacgccatggat
agaagtttctacttctttagagttctcttccagcctcacacacaaaaagaacggcacata
aaacctccggaccgcactcaccatcgcatatcgaaagtgaccctcgaccctctggcgcat
ttacatgctttggagatactaaacctcagcaacaaagctatccactacttctcgctggat
cagcccctgcctccttcctcacaccaaaagcgccacggaggccactcccacagccggctc
cccaggctccaggtgctgatccttcaaaggaatcaactcagtggtactcctaaaggactg
tggaagctgaagtcattgcggagtctggatctgtcattcaacaggatagttcacattggg
ctgtctgattttcatggctgcctgcagctggaaagcatctatttaaagagcaacaagatc
tgcacgattcaccccaaagccttcaaagggctcaaaaaattacaggtggtagacctcaga
agcaatgcactgaccactctggtaccgattgtgaccattgctctagaattgccccacctg
gaacttggcttggctgataaccagtggcagtgtagtgaaagcaatgtcaacttccaaaac
attacctcttcatcctggagggaaatatggaaagccatctgcaacatgtctgtggagaac
aagaggccaaatgcagagactcaccagatcagaaaatccagggatacacaccttcttctg
tctcctccaagtgacttgaaaagcctcatccagagcaaggcagagaggccccaggcaggg
atggacatgcacctttctgctctggggaaggaggcgaaggatggctatggtgatctcaga
gggatgtggccacagtccccagtagaactcagagattctcaggatgaacaggtcactgac
agaaaggatgacaagcccccagcccttgagctggccatctgcctgtcggtgttcatcacg
tttgtggtggctttctgcctgggggcttttgcaaggccctacattgacaggctacggcaa
cagagatgctcgaataaaaggcccggctcagataatgcctactcaaacaagggcttccat
ggcgacattgaaggtgctcaacacatggagtaccaagggacagatctacaccaaactacc
caccacctacatctttctgagaaccagaacccttcgtgggtggcagagccaatcccacac
agtgctgtccaatcagaacagatgctgggaagcaacggaacagaccccggtcatcagcag
agcccagagcaactcaaggacagcaatgaatcaagaagtggagatagcatcgtgcttcca
agtggccctgtagcccatcttgcgctccatggccttccaaacgctgatgcacacaaggcg
atttcaccagtgcagcatcaccatgattttcttgaagaagcacattatgacacagtggcc
caggaatattctctcattgacgatgtgatggacaggtcttccatcactggccctctggga
actttccccagctctgtcgagagtaggcgggatgacctgcacccatcacagccaagagat
gttgtggcttctttctccaaaactctagcacatgcaaacactagagaggctgaggggagt
atggaaacggggtgccctgaacctttgggagccatggactcacagatgggatcttctgag
gaaaggcaagtgagcaattccattagggaactggccacacagcagccaagcttccagggg
gttgatgctgaggagagactttcccatgtctacagcgaggtcctacacaatgacccaccc
tctcttaggccaagatggggcagtggccattatgtcatccctgctactggggagcctgtg
gagagagatgctccttttgaccctcattatgacttggtgaccaactacgagtctgattcc
gacgagggttctttgtttacccttagttctgagggttctgaagacacaaggagcttggct
gaggaacaggcatctgtggagaatgatgggaccagccagcccctcccaagcaggaacttg
ggggaatacaaggacagtgtgacatcagcagaaagtgttgaggacctcacatcgcaaagg
attccagagaaatgtgaagcgcaggaagctcaccttagaaacactcttatttctggtcca
gactcttgtgtgtgtgagacaaatcaggaaaatgactctagctcccttgaccctgagaat
agatcaacgtggccccaactcccaggacataagttatcacatcatgagactctgggcaca
tatggtgacatagaaccccagtctgaggcagtagactggcactactcccttagagacctg
gaatccccaaatgtagatagttcaccatcaccaccatattctgatgaagatctctcaggt
cctgaggatcgtgcccgcaagagaagtaagcattggtaa

DBGET integrated database retrieval system