KEGG   Mus musculus (mouse): 231326Help
Entry
231326            CDS       T01002                                 

Gene name
Aasdh, A230062G08Rik, A830035E16, Acsf4, U26
Definition
(RefSeq) aminoadipate-semialdehyde dehydrogenase
  KO
K00142  acyl-CoA synthetase [EC:6.2.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    231326 (Aasdh)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     231326 (Aasdh)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Unknown
   231326 (Aasdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding PQQ_3 PQQ_2 PQQ PP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 231326
NCBI-ProteinID: NP_776126
MGI: 2442517
Ensembl: ENSMUSG00000055923
Vega: OTTMUSG00000026517
UniProt: Q80WC9
Position
5; 5 C3.3
AA seq 1100 aa AA seqDB search
MTLQELVLRTASVYMDRTAVCFDEGNNQPPVCYSYKALLSAASELSHFLIAHCDFGGIRE
IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFK
SSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRADQHKVTDREDRVSAESRTPEK
EHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLFDITQEDILFLASPLT
FDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADILFSRHRVTVLQATPTLLRRFGSELI
KSTVLSAHTSLRVLALGGEAFPSLTILKSWRGKGNRTQIFNIYGITEVSSWATFYRIPEE
ILNSAVKHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLGGKNRVCFLDDEMTVPLG
TMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIALVQQVAEELRQVESCAVTWYNQER
LILFIVSKVDLVKDCIFKELQKHLPAHALPDDMVLIDTLPFTCHGKVDVSELNKIYLDYI
SSQPRNELHGKEELWGKLQYLWKSILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSE
IERLTGTAIPGLLEVILSSSLLDVYNHIVQAVFTPEDRKANRSYTTKRKFSDADPEEASG
KPARLESAWPSNHAGETNSVIALSRGSQVLSLGAGRLLTQLGLCLPVCSLDLIPQTNTQI
LKSLSPPAPDENLEKPPLFQQGSPVVGAMAMALRERWRSDTGKCVDASPLLVRAAVQDKP
STTVYIGSHSHTVKAVDLSSGETRWEQLLGDRIESSACVSKCGNFIVVGCYNGLVYVLKS
NSGEKYWTFTTEDAVKSSPAVDPTTGLIYVGSHDQHAYALDIYEKKCVWKLNCEGALFSS
PCVSLSPHHLYCATLGGLLLALNPASGSTVWKRSCGKPLFSSPRCYQQYICIGCVDGSLL
CFTHSGEQVWRFAAGGPIFSSPCVSAAEQEIFFGSHDCFIYCCSKEGHLRWKFETTARVY
ATPFAFSNHPRSDDALLAAASTDGKLWVLESRSGELRSVYELPGEVFSSPVVWESMLVIG
CRNNYIYCLDLLCGDKNNQV
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcaggagttggtgcttcggactgcctctgtctatatggatagaacagctgta
tgttttgacgaaggcaataaccagcctccagtgtgctattcctacaaggctctgttgagc
gcggcttcagaattatcccattttctgatagcacactgtgactttggaggaattcgggaa
attggtctctattgtcaacctgggataaacttaccctcctggattttagggattcttcag
gtccccgcagcgtatgcgcccattgatccagactccccaccgtccttatcaacttacttt
atgaaaaaatgtgacctaaagtatgttctcgttgaaaaacagcagcttagtaaattcaaa
tcttcacatgagacagttctgaactatgacacagtttccgtggaacacaaggacctggca
ctcttcagactgcattgggaagatggtcgggtgagcacagtgcttggtgacagagcagat
cagcacaaggtgacggatagagaagacagagtgagtgctgagagcaggaccccagagaag
gagcacatggacatgcggcatgacggttgcttggcttatgtcctccatacctcagggacc
acggggacaccgaagattgtcagagtgccccatgcatgcatactgcctaatatccagcac
ttccggtcactttttgacatcactcaagaagacattttgtttctggcttctcctctgacc
ttcgatccatctgttgtggagatatttgtttctctgtccagtggggcctgcctgcttatc
gtgccaacttctgtcaaagtgctaccatcaaaattagctgacattctcttttcccgccac
agagtgactgttttacaggcaacgccaacattgctgagaagatttggatctgagctcatc
aagtccactgtcctgtcagcgcatacgtctctgagagtcctggccctcggtggggaagcc
ttcccctcgctgaccatcctcaaaagctggcgaggcaaaggcaacagaacccagatattt
aacatctatggtatcacagaggtatccagctgggccactttttacaggatcccagaggag
attcttaattctgccgtgaaacatgaatcccctgtgcagctggggtcgccactacttgga
acggtgattgaagtcagagaccaaaatggttctccagttctcgaaggcactggccaagta
tttttaggtgggaagaacagagtgtgttttcttgatgatgaaatgacagtgccccttggc
accatgagagccacaggagactttgtgactgtgaaagatggagagatatttttcttggga
agaaaggacagccagatcaagcgccatggcaaacgtcttaacattgcacttgtgcaacag
gttgctgaagaacttcgccaggtggagtcctgcgcggtcacttggtataatcaggaaaga
ttgattctcttcatcgtatccaaagttgacttagtaaaggactgcatctttaaagaattg
cagaaacaccttccagcacacgccctgcctgatgacatggtgctgatcgataccctgcca
tttacatgccatggcaaagttgatgtttctgagttaaacaagatatatttagactacata
agctcacagcctaggaatgaactccatggaaaagaggaactttggggaaaattacagtat
ttatggaagtctattctgtgtctccctgaggatccagaggatactctgaaggttcccgcc
aactccgtctttttagatagtggtggggattccctcaagtccatgcggctcctcagtgag
attgagaggctcaccgggacagccatccctggccttctggaagttatcctcagcagttcc
ctcttagacgtttacaaccacatcgttcaagccgtgttcacaccggaggacaggaaagcc
aacaggagttacaccacaaaaaggaaattcagtgatgctgatccagaggaagccagcggg
aagcctgcacgtctggagtctgcctggccttcgaaccatgccggcgagaccaactccgtg
atcgctctgagcagagggagtcaggttttgtctcttggcgctgggaggcttttaactcag
ttaggactctgcctgccagtctgttctctggatttaatcccacagactaacactcagata
ttaaaaagcctaagtcctccagctcctgatgaaaacttggaaaagcccccactttttcag
caggggagccccgtggttggggctatggcgatggcattgcgggagaggtggcggtcagac
acaggcaaatgcgttgatgcctcccctctgctggtgagagcggctgtacaggataagccc
tccacaaccgtgtatattggctcgcactcgcacacagtgaaggctgtcgacctgtcctct
ggggagacgaggtgggaacagcttctgggagatcgaattgaatcctcagcgtgtgtgtct
aaatgtggaaactttattgtagtgggctgttataatggattagtctatgtcctaaaaagt
aatagtggagaaaaatattggacatttactactgaagatgctgtcaaaagctcaccagcc
gtggatccaaccacaggactcatttatgtcggatctcatgaccagcacgcatatgcttta
gacatttatgaaaagaaatgtgtctggaagctaaactgtgaaggcgctctcttttcctct
ccgtgtgtgagcctgagtccacaccatctgtactgtgctacgctagggggactcttactg
gccctaaatcctgcttctgggagcacggtgtggaagcgctcctgtggaaagccactcttc
tcttccccacggtgctaccagcaatacatctgcatcggctgcgtggacggcagtttgctc
tgtttcacacactcaggggagcaggtctggcgctttgctgctggagggccaatcttctca
tccccatgcgtctcggcagcagaacaagaaatattttttggttcccatgactgctttatc
tactgctgtagcaaggaaggtcacctccggtggaaatttgagacgacagccagggtgtat
gcaacgccctttgctttcagtaaccacccccgtagcgatgatgcactgctggcagcggca
tccactgacgggaaactgtgggtcctcgagtctcggagcggagagctgcgaagtgtgtat
gaactccccggagaagtcttctcctctcctgtggtctgggaatcaatgcttgttattggg
tgcagaaacaattatatttactgtctggatttattgtgtggtgataaaaataaccaggtg
tag

DBGET integrated database retrieval system