KEGG   Mus musculus (house mouse): 231386
Entry
231386            CDS       T01002                                 
Symbol
Ythdc1, A730098D12Rik, C80342, mKIAA1966
Name
(RefSeq) YTH domain containing 1
  KO
K20100  YTH domain-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    231386 (Ythdc1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    231386 (Ythdc1)
SSDB
Motif
Pfam: YTH
Other DBs
NCBI-GeneID: 231386
NCBI-ProteinID: NP_808348
MGI: 2443713
Ensembl: ENSMUSG00000035851
UniProt: E9Q5K9 Q8C4W4
Position
5:86951349..86984518
AA seq 736 aa
MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSERMESTDTKRQ
KPSIHSRQLISKPLSSSVSNNKRIVSTKGKSVTEYKNEEYQRSERNKRLDADRKIRLSSS
SSREPYKSQPEKTCLRKRDSERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEDYG
SDHETGSSGSSEQGNNTENEEEGGEEDVEEDEEVDEDAEDDEEVDEDAEEEEEEDEEEEE
DEDEDEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSFTDGSVRSGSGTDGSDEKKK
ERKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKYVLQDARFFL
IKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSES
HHGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQE
IELECGTQLCLLFPPDESIDLYQLIHKMRHKRRMHSQPRSRGRPSRREPVRDVGRRRPED
YDIHNSRKKPRIDYPPEFHQRPGYVKDPRYQEVDSFTNLIPNRRFSGVRRDVFLNGSYND
YVREFHNMGPPPPWQGMPPYPGIEQPPHHPYYQHHAPPPQAHPPYSGHHPVPHEARYRDK
RVHDYDMRVDDFLRRTQAVVSGRRSRPRERDRERERDRPRDNRRDRERDRGRDRERERER
ICDRDRDRGERGRYRR
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcggccgacagccgggaggagaaagatggggaacttaatgttttggatgatattttg
actgaagtaccagaacaggatgatgaattgtataatccagagagtgaacaagataaaaat
gagaaaaaaggatcaaaaagaaaaagtgagagaatggagtctactgacaccaagcgacaa
aaaccttccatccattcaagacaattgatttctaagccactaagctcatctgtaagcaat
aataaaagaatagttagtacaaaaggaaagtcggttacagaatataaaaatgaggaatat
caaagatctgaaaggaacaagcgtctagatgctgatcgaaaaattcgtctgtcaagcagt
tcctctagagaaccttacaagagtcaaccagaaaaaacttgtctacggaaaagggattct
gaaagaagggccaagtctcctacaccagatggttctgagagaattgggcttgaagttgat
agacgtgcaagcagatccagccagtcttcaaaggaagaggtgaactctgaagactatggc
tctgaccacgagacaggaagcagtggttcttctgaacagggcaacaacactgagaatgag
gaggaaggaggggaggaagatgtagaggaagatgaagaggtagatgaagatgcagaagat
gatgaggaagtggatgaagatgcagaggaggaggaggaagaggatgaagaggaagaagag
gatgaggacgaggatgaagaggaagaagaatatgaacaggatgagagagatcagaaggaa
gaagggaatgattatgacacccgaagtgaggccagtgattctggttccgagtctgtttcc
ttcacagatggatctgtcagatctgggtcaggaacagatggatcagatgagaaaaagaag
gaaaggaagagagctcgaggcatatcacccattgtctttgatagaagtggcagttctgca
tcagagtcatatgcaggttcagaaaagaagcatgagaaattatcatcttccgttcgtgct
gtccgaaaagatcaaaccagtaaactcaaatatgtccttcaggatgcaagatttttcctc
ataaagagtaataaccatgagaatgtgtctcttgccaaagcaaagggtgtatggtccaca
ttgcctgtaaatgagaagaaattaaatcttgcatttagatctgcaaggagtgttatatta
atattttctgtcagagaaagtggaaaatttcaaggttttgccagattgtcttcagaatca
caccatggcggatctcctatacactgggtgcttccagcaggaatgagtgctaaaatgctt
ggaggtgtttttaaaatagactggatttgcaggcgtgaattaccctttactaaatcagct
catctcaccaatccctggaatgaacataagccagtaaagattggacgtgatggacaggaa
attgaacttgaatgtggaactcagctttgtcttctgtttccccctgatgaaagtattgac
ttgtatcagctcattcataaaatgcgtcacaagagaagaatgcattctcagcctcgatca
agaggacgtccatcccgtcgagaaccagtccgggatgtgggaaggcgtcgaccagaagat
tatgatattcataacagcagaaagaaaccaaggattgactatccccctgagtttcaccag
agaccagggtatgtaaaggatccccgataccaggaagtggacagttttacaaatcttatt
cccaacagacgattttcaggagttcgccgagatgtgtttttaaatgggtcctacaatgat
tatgtgagggaatttcataacatgggaccaccgcctccttggcaaggaatgcctccttac
ccgggaatagaacaacctccacaccatccttactaccagcaccatgccccacctcctcaa
gcccaccccccttactcaggacaccatccggtaccacatgaagcaagatacagagataaa
cgagtacatgactatgatatgagggtcgatgatttccttcgccgcacgcaagctgtggtc
agtggtcggagaagtagacctcgagaaagagatcgggagcgagagcgagaccgccccaga
gataacagaagagatagagagcgagacagaggtcgtgatcgagaaagagagagagaaaga
atatgtgatcgggacagagaccgaggggagagaggtcgttatcgaagataa

DBGET integrated database retrieval system