KEGG   Mus musculus (house mouse): 231440
Entry
231440            CDS       T01002                                 
Symbol
Parm1, 2210012L08Rik, 9130213B05Rik, W91666
Name
(RefSeq) prostate androgen-regulated mucin-like protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PARM DUF4690
Other DBs
NCBI-GeneID: 231440
NCBI-ProteinID: NP_663537
MGI: 2443349
Ensembl: ENSMUSG00000034981
Vega: OTTMUSG00000035368
UniProt: Q923D3
Position
5:91665559..91771870
AA seq 296 aa
MVCKVLIALCIFTAGLRVQGSPTVPLPVSLMTKSSAPVATWTTSAPHTARATTPVASATH
NASVLRTTAASLTSQLPTDHREEAVTSPPLKRDVNSTDSSPAGFPSTSSDGHLAPTPEEH
SLGSPEATVPATGSQSPMLLSSQAPTSATTSPATSLSESLSASVTSSHNSTVANIQPTEA
PMAPASPTEEHSSSHTPTSHVTAEPVPKEKSPQDTEPGKVICESETTTPFLIMQEVENAL
SSGSIAAITVTVIAVVLLVFGGAAYLKIRHSSYGRLLDDHDYGSWGNYNNPLYDDS
NT seq 891 nt   +upstreamnt  +downstreamnt
atggtctgcaaggtgctcatcgccctctgcatcttcaccgcaggactgagggtacagggt
tcaccaacagtcccattgcctgtctctctcatgacaaaaagttcagcacctgtggccacc
tggactacctctgctccacacactgctagggccaccacccctgtagccagtgccactcac
aacgcctcagttctccgcaccactgccgcatccctgacatctcagctccccactgaccac
agagaagaagctgtcaccagcccacctttgaagagggatgtcaacagcacagactcctca
cctgccgggttcccctcaacaagcagtgatggccacttggcacccacacctgaggaacac
agtcttggaagtcctgaagcaactgtgccagctactgggtcacagtcacccatgctcctg
tcttctcaggctccaacctcagcaaccacatcccccgcaacttccctatcggagtctctc
tctgcctccgttacctctagccacaactctacggtggccaacatccagcccacagaagct
ccaatggcacctgcgtcaccaacagaagagcacagctctagtcacacacccacttcccat
gtcacagcagagccagtgcccaaggagaaatcaccccaagacactgaacctggcaaagtg
atctgtgagtctgagaccaccacccccttcctgatcatgcaagaagtggagaatgcctta
agttcaggcagcatcgccgccatcaccgtgacagtcatcgccgtagtgttgctggtgttt
ggaggtgcagcatacctgaagatcaggcactcctcctatggaaggctgctggacgaccat
gactacgggtcctgggggaactacaacaaccctctctacgatgactcttaa

DBGET integrated database retrieval system