KEGG   Mus musculus (house mouse): 231464
Entry
231464            CDS       T01002                                 
Symbol
Cnot6l, 4932442K20Rik
Name
(RefSeq) CCR4-NOT transcription complex, subunit 6-like
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    231464 (Cnot6l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    231464 (Cnot6l)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     231464 (Cnot6l)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     231464 (Cnot6l)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     231464 (Cnot6l)
SSDB
Motif
Pfam: Exo_endo_phos LRR_8 LRR_4
Other DBs
NCBI-GeneID: 231464
NCBI-ProteinID: NP_849185
MGI: 2443154
Ensembl: ENSMUSG00000034724
UniProt: Q8VEG6
Position
5:complement(96218192..96312044)
AA seq 555 aa
MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTA
LHLNDNNLARIPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNDNYLRVLPYE
LGRLFQLQTLGLTGNPLSQDIMSLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKER
DQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQE
VETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAH
MHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV
EYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGFQLKSAYENNLMPYTNY
TFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHP
PLLPLVNGVHLPNRR
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgagactaatagggatgccaaaggaaaaatatgatcctccagatcctcgcagaatttac
accatcatgtccgcagaggaggtagccaatgggaaaaaatctcactgggcagagttagag
atctcgggtagagtgcggagcttaagtacatcactctggtcattaacacacttgacagca
ctgcacctaaatgacaataaccttgctcgcattccacctgatattgccaagcttcataat
ctggtttacctggatctgtcatccaataaactcagaagtttaccagcagaactaggaaac
atggtgtctctcagggaattgcttttaaatgacaattatttacgggtgttgccttatgaa
cttggccggctcttccagctacaaactctaggtttaacaggcaatcctttatcacaggat
attatgagcttataccaggacccagatggaacccgaaagctactgaacttcatgcttgac
aatcttgcagttcatccagagcagcttcctccgaggccatggattacattaaaagaacga
gaccaaattctgccatcagcatcattcacggttatgtgttacaatgtgttatgtgataaa
tatgctaccaggcagctatatggctattgtccgtcctgggcattaaactgggaatacagg
aaaaagggaattatggaagaaattgttaactgggacgcagatatcattagtcttcaggaa
gtggaaacagagcaatactttactctctttctgccagcattgaaggatcgtggatatgat
ggatttttttctccaaagtcacgtgccaaaatcatgtctgagcaggaaagaaagcatgtg
gatggttgtgcaatattcttcaaaacagaaaaatttacattggtgcagaagcatacagtg
gaattcaaccaggtagcaatggcaaattcagatggatccgaagcaatgctaaacagagta
atgacgaaagataacattggcgttgctgtggtgttagaggtccacaaggagctttttgga
acaggtatgaagcctattcatgctgcagacaaacagctgcttatagtggcaaatgcccac
atgcattgggacccagagtattctgatgtgaaacttattcagaccatgatgtttgtctca
gaggttaaaaacattctggagaaagcctcaagtaggcctggcagcccaactgcagatccc
aattccatcccgctggtgctatgtgcagatcttaactcattgccagattcaggtgttgtg
gaatatttaagcaacggtggagtagctgacaaccataaagacttcaaggaactaaggtac
aatgagtgtcttatgaacttcagctgtagtggaaagaatggaagctcagaagggagaatc
acacatggcttccaacttaagagcgcctatgaaaataacttgatgccttataccaattac
acctttgatttcaaaggtgtgattgactacattttctattccaagactcatatgaacgtg
cttggtgtcctggggcctttagatcctcaatggctggttgagaacaacatcactgggtgt
ccacaccctcacatcccttcagaccacttctcactgttaacacaacttgaactccaccct
ccactcctgcctcttgtcaatggtgttcacttgcctaatcggaggtag

DBGET integrated database retrieval system