KEGG   Mus musculus (mouse): 231470
Entry
231470            CDS       T01002                                 

Gene name
Fras1, E130113P14Rik, b, bl, mKIAA1500
Definition
(RefSeq) Fraser extracellular matrix complex subunit 1
  KO
K23379  extracelluar matrix protein FRAS1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    231470 (Fras1)
SSDB
Motif
Pfam: Cadherin_3 Calx-beta VWC Big_9 Cadherin_4 Furin-like GF_recep_IV Furin-like_2 VSP
Other DBs
NCBI-GeneID: 231470
NCBI-ProteinID: NP_780682
MGI: 2385368
Ensembl: ENSMUSG00000034687
Vega: OTTMUSG00000053289
UniProt: Q80T14
Position
5; 5 E3
AA seq 4010 aa
MGVLKAWLGVALALAEFAVLPNCEGACLYQGSFLADATIWKPDSCQNCRCHGDIVICKPV
VCKNPRCAFEKGEVLWIAPNQCCPQCAPRTPGSCHHEGKIHEHGTEWASAPCTVCSCTHG
EVRCSHQQCTPLSCGPQELEFLAEGRCCPICVGTGKPCSYDGHVFQDGEDWQLSRCAKCV
CRNGLTQCFAAQCQPLFCNQDEIVVRVPGKCCSQCSARSCSTAGQVYEHGEQWKEDACTL
CMCDQGQVRCHKQVCPPLRCAKGQGRARHHGQCCEECATPDRSCSSGGVLRYQDEMWKGS
ACEFCMCDQGQVTCQTGECAKVACALGEELVHLEGKCCPECISRNGYCIYEQKAETMSSS
AREIKHVPDGEKWEEGPCKLCECREAQVTCYEPSCPPCPVATLALVVKGQCCPDCTPVHC
HPDCLTCSHSPDHCDLCQDPTKLLQNGRCVHSCGLGFYQAGSLCLACQPQCSTCTNGLEC
SSCLPPLLMQQGQCVSTCGDGFYQDHHSCAVCHESCAGCWGPTEKHCMACRDPLQVLRDS
SCENTCGNGFYNRQGTCVACDQSCKSCGPSSPRCLSCAEKTILHDGKCISECPHGYYADS
TGSCKVCHSSCASCSGPTAAHCIACIHPQTLRQGHCLPSCGEGFYPDHGICEACHASCHT
CVGPQPSHCTQCKKPEAGLLVEQHSGENVPYGKCVSRCGTHFYLESTGLCEVCHPSCLTC
EGKSPHNCTGCESTHALLAGCCVSQCPETHFNLEGTCTECHPSCRQCHGPLESDCVSCHP
HLTLTSGHCKTSCKEEQFLNLVGYCADCHPLCQHCVANLQDTGSICLKCQHARHLLLGDH
CVPECPPGHYKERGTCKTCHSSCRSCQNGGPFSCSSCDTGLVLTHIGTCSTACFPGHYLD
DNQVCQPCNRHCRSCDSQGSCTSCRDPSKVLLFGECQYESCTPQYYLDIATKTCKECDWS
CNACTGPLRTDCLQCMDGYVLQDGVCVEQCSPQHYRDSGSCKRCDSHCVECQGPHECTRC
EEPFLLFQAQCVQECGKGYFADHAKHRCIACPQGCLRCSHKDRCHLCDHSFFLKSGLCMP
TCVPGFSGHSSNENCTDKMYTPSLHVNGSLTLGIGSMKPLDFSLLNIQHQDGRVEDLLFH
VVSTPTNGQLLLSRNGKEVQLEKAGHFSWKDVNEKKVRFVHSKEKLRKGYFSLKISDQQF
FSEPQLINIQAFSTQAPYVLRNEVLHVSKGERATITTQLLDIRDDDNPQDVVVNVLDPPL
HGQLLQMPPAPAASIYQFHLDELSRGLLLYAHDGSDSTSDIIVFQANDGHSFQNILFHVK
NIPKNDRALRLVTNSMVWVPEGGMLKITNRILKAQAPGVRADDIIYKITHSRPQFGEVVL
LMNLPADSPAGPAEEGHHLPDGRMATPISTFTQQDIDDGVVWYRHLGAPTQSDSFRFQVS
SATSAQEHLESHMFNIAILPQAPEAPKLSLGTSLHMTAREDGLSVIQPQSLSFVKAESPS
GKIIYNITVPLHPNQGIIEHRDRPHSPIQYFTQEDINQGQIMYRPPVAPPHLQEIMAFSF
AGLPESVKFYFTVSDGQHTSPEMALTIHLLHSDLQPPAFQVKAPLLEVSPGGRTSLGLQL
LVRDAQVVPEELFFQLQKSPQHGMLVKYTAKSSVTMAAGDTFTYDEVERNVLQYVHDGSS
AWEDSLEISVTDGLTVTTSEVKVEVSPSENRGPRLAPGSSLSMTVASQHTAIITRSHLAY
VDDSSSDPEIWIRLSSLPLYGVLFRSSGPDMDELSGDSNFTMEDINKKNIRYSAVFETDG
HSVTDGFHFSVSDMDGNHVDNQVFTITVTPAENPPHIIAFADLITVDEGGRAPLSLHHFF
ATEDQDNLQDDAVIKLSALPKYGCIENTGTGDRFGPGANSELEASFPIQDVLENYIYYFQ
SVHESIEPTHDVFSFYVSDGSGRSEIHSINITIERKNDEPPRMTLRPLGVRLSSGVAISN
SSLSLQDLDTPDNELIFVLMKKPDHGHLLRRSTASDPLENGTVLDQGSSFTYQDVLAGLV
GYLPGDIYMAVDEFRFSLTDGLHVDTGRMEIYIELPSTNIPHLAINRGLQLSAGSVARIT
EQHLKATDTDSEAGQVVYIMKEDPGAGRLLMAKADNLEQISVRGPIRSFTQADVSQGQIE
YSHGPGEPGGSFAFKFDVVDGEGNKLADQSFSIGVLEDKSPPVVITNRGLVLDENSVEKI
TTAQLSATDQDSKPTELIYRITTQPQLGHLEHVASPGIQISSFTQADLASRNVQYVRSSG
TGKQSDAFSFVLSDGLHEVTQTFPITIHPVDDARPLVQNRGMRVQEGVRKTITEFELKAV
DVDTEAESITFTIVQPPRHGTIERTARGQRFHQTSSFTMEDIYQNRVSYSHDGSNSLKDR
FTFTVSDGTNPFFIIEEGGEEIMTAAPQQFHVDILPVDDGTPRIVTNLGLQWLEYMDGKA
TNLITKKELLTVDPDTEDSQLIYEVTTGPMHGYLENKLQPGRAAATFTQEHVNLGLIRYV
LYEEKIQKVMDSFQFLVKDSKPNVVSDNVFHIQWSLISFKYTSYNVSEKAGSVSVTVQRT
GNLNQYAIVLCRTEQGTASSSSHPGQQDYMEYAGQVQFDEGEGTKSCTVIINDDDVFENI
ESFTVGLSMPAYALLGEFTQAKVVINDTEDEPTLEFDKKTYRVNESAGFLFAPIKRQGDS
SSTVSAVCYTVPKSAMGSSLYALESGSDFKSRGRSAESRVIFGPGVTVSTCDVMVIDDSE
YEEEEEFEIALADASNNARIGRQAVAKVLISGPNDASTVSLGNTAFTISEDAGTVKIPVI
RHGTDLSTFTSVWCATRPSDPASATPGVDYVPSSRKVEFGPGITEQYCTLTILDDTQYPV
IEGLETFVVFLSSAQGAELTKPSQAVIAINDTFQDVPSMQFSKDLLLVKEKEGVLHIPII
RSGDLSYESSVRCYTQGHSAQVMEDFEERRNADSSRITFLKGQKTKNCTVYIHDDSMFEP
EEQFRVYLGHPLGNHWSGARIGKNSVATVTISNDEDAPTIEFEEAAYQVREPAGPEAIAV
LSIKVIRRGDQNRTSKIRCSTRDGSAQSGVDYYPKSRVLKFSPGVDHIFFKVEILSNEDR
EWHESFSLVLGPDDLVEAVLGDVTTATVTILDQEAAGSLILPAPPIVVTLADYDHVEELA
KEGVKKAPSPGYPLVCVTPCDPRYPRYAVMKERCSEAGINQTSVQFSWEVAAPTDGNGAR
SPFETITDNTPFTSVNHKVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNVVTIGTDSA
ICHTPVVAGTARGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPLHN
LHFLLSESIYRHQHVCSNLVTAQDLRGLAEAGFLNDAGFHSTALGPGYDRPFQFDSSVRE
PKTIQLYRHLNLKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYVSY
IYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVIEF
KTHAKFRGQFVIEHHTLPDVKSFILTPDHLGGIQFDLQLLWSAQTFDSPHQLWRATSSYN
RKDYSGEYTIYLIPCTVQPTQPWVDPGEKALACTAHAPERFLIPIAFQQTNRPVPVVYSL
NTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLHSAYKLQLE
KVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRSQPEVTDKYFHDVP
FEAHFASELPDFQVVSSMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDSTSRPRVQR
SLTVSLRRHQRDLVDPSGWLSLDDSLIYDNEGDQVKNGTNMKSLNLEMQEPVIAASLSQT
GASIGSALAAIMLLLLLFLVACFVTRKCQKQKKKQPPEDTLEEYPLNTKVDVAKRNADKV
EKNANRQYCTVRNVNILSDNEGYYTFKGAKVKKLNLEVRVHNNLQDGTEV
NT seq 12033 nt   +upstreamnt  +downstreamnt
atgggtgtcctcaaagcgtggctcggggtggccctagcgctggcggaatttgcagtattg
cctaattgtgaaggtgcttgtctgtatcagggctccttccttgcggatgctacaatttgg
aagcctgattcatgccagaactgtcgttgccatggtgatattgtgatctgcaaacctgtt
gtttgcaaaaaccctcggtgtgcctttgagaagggagaagtgctgtggattgcccccaac
cagtgctgcccacagtgtgcacccaggactcctggctcttgtcaccatgagggaaagatc
catgagcatggcacagagtgggcttcagctccatgtactgtgtgctcttgtacacatgga
gaggtgagatgctcacaccaacaatgcaccccattatcatgtggaccacaggagctggaa
ttccttgctgaaggacgctgctgccctatctgtgtgggcactgggaaaccctgttcctac
gatggccatgtgtttcaagatggagaggattggcaactgagccgctgtgccaagtgtgta
tgcagaaacgggctcactcaatgctttgccgctcagtgccagcctctgttttgtaaccag
gatgaaattgttgtccgagtccctggaaaatgctgctctcagtgctcagcgagatcctgc
tctacagctggccaagtgtacgagcatggtgaacagtggaaagaagatgcctgtaccctg
tgtatgtgtgaccagggacaggtcaggtgtcacaagcaggtgtgccctccactgagatgt
gcaaagggtcaaggccgagcccggcatcatgggcagtgctgtgaggaatgtgcgactcct
gacaggagctgctcatctggtggggtcctgcggtaccaggatgaaatgtggaagggctcg
gcctgtgagttctgcatgtgcgaccaaggccaagtgacctgccagacaggagagtgtgcc
aaggtggcctgtgccctgggtgaagaattagttcacttagaaggaaaatgctgcccagaa
tgcatttcaaggaatggttattgtatttatgaacagaaggcagagactatgtcttcaagt
gcaagagaaattaagcatgttccagatggggagaagtgggaagaaggcccttgcaagctg
tgtgagtgccgggaggctcaagttacttgctatgaaccgtcttgcccgccatgtccagtg
gccaccctagccctagtggtaaagggacaatgctgtccagactgcacaccagtacactgc
cacccagactgcctgacctgctctcattctccagaccactgtgacctctgccaggatccc
acaaagctgctgcagaatgggcgatgtgtgcacagctgtggcctgggcttttaccaagca
ggcagtctttgtttagcctgtcagccccagtgctccacatgcaccaatggcctggagtgt
tcatcttgcctgcctcccctgctgatgcagcagggacagtgtgtgtccacctgtggggat
ggtttctaccaagatcaccattcatgtgcagtctgtcatgagtcctgtgcaggttgctgg
ggtcccacagagaagcactgtatggcctgcagagacccactgcaagtgctgagagatagc
agctgtgagaacacctgtggcaatggcttctacaacaggcaggggacctgcgttgcgtgt
gaccagtcctgtaagagctgtggccctagtagtcccagatgtcttagctgtgctgagaag
acaatcttgcatgatgggaagtgcatttctgaatgccctcatggctactatgctgattct
actggaagctgcaaagtttgccactcatcctgtgccagctgctctggacctacagctgct
cactgtatagcctgtatccatccccagacacttcgtcaaggccactgtctgccaagctgt
ggagaaggcttctaccctgaccatgggatctgtgaagcctgccatgcctcctgccacaca
tgtgtggggccccagccttctcactgtacccagtgtaagaagccagaggcaggactactg
gtggaacagcactcaggggaaaatgtcccctatggcaagtgtgtgtcccggtgtggaacc
cacttttacttggagagcactggactgtgtgaagtttgccacccatcctgcctcacgtgt
gaaggaaagagccctcacaactgcacgggctgtgaatccacccacgcactactggctggg
tgctgcgtctcccagtgtcccgagacccactttaacctggaaggtacttgtacagaatgt
cacccgtcctgcaggcagtgccatggtcctctggaatcagactgtgtctcctgccaccct
caccttactctcaccagtgggcactgtaagaccagctgcaaggaagagcaattcctgaac
ctcgtcgggtactgtgctgactgccatcctttgtgccagcactgtgtggccaatctccaa
gacactggtagtatctgcctaaagtgtcagcatgcccgccacctgctgcttggagatcac
tgtgtgccagaatgccctcctggacactataaagagagaggcacttgtaaaacatgccat
tcctcctgcagaagctgccagaatggaggacctttctcctgctcctcttgtgacactggt
ctggttctgacccacattggtacctgtagcaccgcctgcttccctgggcattacctggat
gataaccaagtttgccagccatgcaacaggcattgcagaagctgtgattcacagggcagc
tgcacctcctgccgagatccaagcaaggtcctgctctttggggaatgccagtatgagagc
tgcaccccccagtactaccttgacatcgccacgaagacttgcaaagagtgtgactggagt
tgcaacgcctgtactgggcctcttcgaacagactgtctgcagtgcatggacggctatgtt
ctccaggatggtgtgtgtgtggagcagtgctcaccacaacactaccgggactccggctcc
tgcaagcgctgtgacagccactgtgttgagtgccagggtccccatgagtgcacacgctgt
gaagagccctttctcctcttccaagcccagtgtgtccaagaatgtgggaaaggatacttt
gcagatcatgccaagcacagatgcatagcctgccctcagggatgcttgcggtgcagccac
aaagatcggtgtcacttatgcgaccacagtttctttctgaagagtggtctctgcatgccc
acctgtgtccctggtttctctggccactcatctaatgaaaactgtactgacaaaatgtac
actccaagtcttcatgtgaacggctccttgacccttggaattggttcaatgaagccactg
gacttttctctcctgaacatccaacaccaggatggcagagtggaagatctgctgttccac
gttgtaagcacacccaccaacggtcagctgctgctctcaagaaatggcaaggaggtccag
ctggagaaggctggccattttagctggaaagatgtgaatgagaagaaagtgcgctttgta
cacagcaaagagaagctcaggaaaggctacttttccttgaaaattagtgaccagcaattc
ttctctgagccacagctgatcaacatacaggccttttcaacgcaggctccgtatgtgctg
agaaatgaagttctccacgtcagcaaaggagagcgggcaaccatcaccacccagctgctt
gacatccgggatgatgacaacccgcaggatgtggtcgtgaatgtgcttgatcctcctctt
catggccaattgctccaaatgcctccagcccctgcagcctctatttatcagttccatctg
gatgagctctccaggggcctcctcctctatgctcacgatggctcagacagcacatctgat
attatagtctttcaggccaatgatggacactccttccaaaatatactgtttcacgtgaag
aacatacccaagaatgacagagctctgcgacttgtgaccaactctatggtgtgggttccg
gaagggggaatgctgaagatcaccaaccgaatcttgaaggcccaagctccaggtgtcaga
gccgacgacatcatctacaagattacacacagccgcccccagtttggggaggtggtcctc
ctgatgaatctgcctgcagacagtccagccggtcctgcggaggaagggcatcacctgcct
gatggaaggatggcaacccccatcagtacctttacccagcaggacatcgatgatggcgtt
gtgtggtacagacacttgggagcccccacgcagagtgactccttccgctttcaggtgtct
agtgccaccagtgcccaggaacacctggaaagtcacatgttcaacattgcaatcttacct
caggcgcctgaggcacctaaactctccttggggacatctctccatatgaccgctcgtgaa
gatggcctaagtgttattcagccccagtccttatccttcgtgaaggcagagagtcccagt
ggaaagattatatacaacatcaccgtacctctgcatccaaatcaaggtatcattgaacac
agagaccggcctcactctcccatccagtatttcactcaggaagatataaaccaaggacag
atcatgtatcgccctcctgtggcacctccccacctccaggagatcatggccttctcattt
gctggtctcccagaatcagtgaaattttacttcacagtttctgatgggcagcacacgagt
ccagagatggccctcaccattcacttgctgcactctgatctgcaaccaccagcatttcag
gtcaaggctcccctgctggaagttagccctggaggccggacctctttaggcctgcagttg
ttagtgagagatgctcaggtggtgccagaagagctcttcttccagcttcagaagtctcct
cagcatggcatgctcgtgaagtacacggcaaagtcctcggtgaccatggctgcaggtgac
acttttacatatgatgaagtcgagagaaacgttctgcagtacgtacatgatgggtcctct
gcgtgggaggacagcctggagatctcagtcacagatggcctgacagtgacaacatcagaa
gtaaaagtggaggtgtccccatcagagaaccgagggcccaggctggcccccggctcctcc
ctgagcatgacggttgctagtcaacacacggccataatcaccaggtcacaccttgcctat
gtggatgattcttcctctgacccagagatctggattcggttaagttctctgccactgtat
ggcgtactcttcagaagctcagggcctgacatggacgagctctcgggggattccaacttc
accatggaggacatcaacaagaagaacattaggtactcagctgtgtttgagacggacggg
cattcggttacagatggcttccacttctctgtctcagacatggacggcaaccatgtggac
aaccaggtctttaccatcacggtcactcctgccgagaaccctccacacatcattgccttt
gctgaccttatcacggttgatgagggagggagagcaccactctctctccaccacttcttt
gcgactgaagatcaggacaaccttcaggacgacgctgtcattaaactaagcgctctgccc
aagtatggctgcatcgagaacacaggaacaggagatcgctttggcccaggagccaacagt
gaactggaggcgtcattccctattcaagatgtcctagaaaactacatttattactttcag
agcgttcatgaaagcatcgagccgacccacgatgtgtttagtttttatgtgagtgacgga
agtggtcgctctgaaatccacagcatcaatatcaccattgagaggaagaacgatgagcct
cccaggatgaccttgcggcccctgggcgtacggctgagctcgggagtggcgataagcaat
tcttccttgagtctacaagatctggacaccccagataacgagctgatctttgtattgatg
aaaaagcctgaccatggtcatctactccggaggtctactgcctctgaccctctagaaaat
gggacagtcttagaccaaggctcctccttcacctatcaggatgtcctagctgggctggtt
ggctacttacctggtgatatctatatggcagtcgatgagttccggttctctctcacggat
ggcctccatgtagacacaggaagaatggagatctatatagaactgccatcaaccaacatt
ccccacttggcaataaaccgaggacttcagctttcagcagggtccgtagcacgcatcaca
gagcagcacttgaaagcaacagacactgactctgaggccggccaggttgtatacatcatg
aaggaagaccctggtgcagggcgtctgctgatggctaaggctgacaacctagagcaaatc
tctgttagaggccccatccggagcttcacccaggcagacgttagccaagggcagatagaa
tacagccatggaccaggagaacctggtgggagctttgcttttaaatttgatgtggttgat
ggggaaggcaataagttggctgaccagtcattttccatcggtgttttagaagacaaatcc
ccaccagtcgtcatcaccaatagagggctggtcttagatgagaactcggtggagaaaatc
actactgcacagctgtcggccaccgaccaggacagcaaacctacagaactcatctacagg
atcaccactcagccccagctgggccacctggaacatgtggcctccccaggcatccagatt
agttccttcactcaagctgacctggcttcacgcaatgttcaatatgtccgttctagtggg
accgggaaacaatcagacgccttcagcttcgtgctgtctgatggcttgcatgaggtgaca
cagaccttccccatcactattcaccctgtggatgatgcgcggccccttgtgcagaaccgg
ggcatgcgtgtgcaagagggtgtgaggaagaccatcaccgagtttgagctgaaggcagtg
gatgtggacacagaggctgagtccatcaccttcaccattgtgcagcctccacgtcatggc
accatcgagagaactgccagggggcagcgttttcaccaaacctcctccttcactatggaa
gacatctaccagaaccgtgtcagctatagccatgacggcagcaactccctcaaagaccga
tttaccttcaccgtttctgatgggaccaaccccttctttatcattgaggagggaggagaa
gagatcatgacagcagcccctcagcagttccatgtggacattctcccggtggatgacggc
acccccagaattgtcaccaatttggggctccaatggctggagtatatggatggcaaggca
accaacctgatcaccaagaaggaactgctgaccgtggatccagacacagaggactcacag
cttatctatgaggtcaccacaggccccatgcatggctacctggagaacaagctgcagccg
ggcagagcggcagccaccttcacccaggagcatgtgaacttggggttgattcgttatgtg
ttgtatgaggagaagatccagaaagtgatggatagttttcagttcctggtgaaggacagt
aaacccaatgtggtcagcgacaatgtcttccatatccagtggtctctcatcagctttaaa
tataccagctataacgtcagcgagaaggcggggtctgtcagtgtcacggtgcagaggact
gggaacctgaaccagtatgccatcgtcctgtgtcgcactgaacaaggcacagcgagctcc
agctctcatcctggacagcaggactacatggagtatgctggccaggttcagtttgatgaa
ggagaaggcacaaagtcctgcactgtcatcatcaacgatgacgatgtatttgagaatatc
gaaagtttcaccgtggggctcagcatgccagcctatgccctgctgggagagttcacccag
gcgaaggtcgttatcaatgacactgaggatgaacctacgttggagtttgataagaagacc
taccgggtcaacgagagcgctgggtttctctttgcacccatcaaaagacaaggagactca
agcagcactgtgtctgccgtttgctacacagtccctaagtcagccatgggaagtagcctc
tatgccctggaatccggatccgactttaagtccagagggaggtctgctgagagtcgtgtg
atattcggacccggtgtcaccgtgtccacctgtgatgtcatggtcattgatgacagcgaa
tatgaggaggaagaggagtttgagatagccctggctgatgcttctaacaatgccagaatt
ggaaggcaggcggtggccaaggtcctcattagtggtcccaatgatgcctcaactgtctcc
ctgggcaacacggctttcaccatcagtgaggatgcaggcacagtgaagattccagttatc
cgtcatggcactgacctttctaccttcacatctgtctggtgtgccacacggccctcggac
ccagcttctgccactccaggagttgactatgtccccagctcaaggaaggtggaatttggg
cccggtatcactgaacaatactgcactttgactatcttggatgacacacagtacccagta
attgaaggactggagacgtttgtggttttcctcagctcagcacaaggagccgaactgacc
aagccctctcaggctgtcattgcaattaatgacacattccaggatgttcccagcatgcag
ttttccaaggatttgcttctagtgaaggaaaaggagggtgtcctgcacatccccatcatc
cggagcggggacctgagttacgagtcatcagtgcggtgttacacgcagggccactctgct
caggtcatggaggactttgaagagagaagaaatgcagactcctccaggattacgtttctg
aaagggcagaagacgaagaactgcactgtgtacatccatgatgactccatgtttgagcct
gaggagcagttcagggtctaccttggccatcctcttggaaatcactggagtggagccaga
attgggaagaacagtgtggccactgtcaccatatccaacgacgaagatgcccccaccatt
gagtttgaagaagccgcataccaagtccgggaacctgcagggccagaagccattgcagtt
ctgagcatcaaggtcatccgcagaggtgatcaaaacaggacctccaagatccgctgcagc
actcgagacggctctgcccagtctggtgtggattattacccgaagagcagagtcctgaaa
ttcagtcctggcgttgatcatatcttcttcaaagtcgagatcctgtccaatgaggaccga
gaatggcatgagtccttttctctagtccttggcccggatgatctggtggaagccgtactt
ggagacgtgacgactgctacagtgaccattctagaccaggaggcagcagggagtctcata
ctgccagcgccacccattgtagtcactcttgctgactatgaccacgtggaagagctggca
aaggaaggtgtcaagaaagccccgtctccaggctacccactagtctgtgtcacaccctgt
gacccacgctaccccaggtatgctgtcatgaaggaacggtgcagcgaggctggtatcaac
caaacatctgtgcagttcagctgggaagtggctgcgcccaccgatggcaatggggctcgg
tctccctttgagaccatcacggataacacaccattcaccagcgtcaaccacaaggtccta
gacagcatttatttcagccggaggttccatgtgcgttgtgtggccaaggctgtggacaag
gtgggccatgtagggacccccttgaggagcaatgttgttaccattggaacagacagtgct
atctgtcacaccccagtcgtggctgggacagctcgaggcttccaggcacagtccttcatt
gcgaccttgaagtacctggacgtcaaacacaaagaacatccaaacagaatccacatctct
gtgcagatccctcaccaggatggaatgctgccccttatctcaaccatgcccctgcacaac
ctgcacttcctgttgtcggagtccatctacagacaccagcatgtctgctccaacctcgtc
acggcgcaggacctgcgaggccttgcagaggcagggttcctgaatgacgccggtttccac
agtactgccctgggccctggctatgaccgccccttccagtttgactcaagtgtacgggag
cccaaaaccatccagctctacagacacctgaacctaaagagctgcgtgtggacctttgat
gcgtactacgatatgacagagcttatcgatgtgtgtgggggctccgtgactgctgacttc
caggtgagagattctgcccagtcgttcctgacggttcatgtgccactctacgtgtcctac
atctatgtgacagcacccaggggctgggcctccttagagcaccacactgagatggaattc
tctttcttctatgacacagttctctggagaacagggatccagacagacagcgtgctctct
gcaaggcttcagataataaggatctacattagagaggatggccgtctcgtcattgagttc
aagacccatgccaaattcagagggcagtttgtgatagagcaccacaccctcccggatgtg
aagtctttcatattgactccagaccacctaggaggaattcagtttgacctgcagctcttg
tggagtgctcagacatttgattctcctcatcaactctggcgagccacgagctcttacaat
cgaaaggactactcgggggagtacaccatctacctgatcccgtgcaccgtgcagcccaca
cagccctgggtggacccaggagagaaggccttggcctgcacggcacatgccccagaaagg
ttcctgatacccatcgcgttccagcagaccaaccgccctgtgccggttgtgtattcgctc
aatactgagtttcagctctgcaataacgagaaggtattcttgatggatcccaacacgtct
gatatgtcactggcagagatggattacaaaggagccttttccaaaggtcagatcctttac
ggccgagtcctttggaatccagaacaaaaccttcattctgcttacaaactgcagctggag
aaagtctatctttgtaccggcaaggatggctacgtgccgttctttgaccctacggggacg
atctacaacgaagggccacagtacggatgcattcagccaaataaacacctgaagcacaga
ttcctgctgctggaccgcagccagccagaggtcactgacaagtacttccacgatgtgcct
ttcgaggctcactttgcttccgagttgcccgatttccaggtggtcagcagcatgccgggt
gtggatggattcaccctcaaagtagatgccctctataaggtggaagcaggacaccagtgg
tatctccaggtgatctacatcattggccctgacagcacctcaaggcctcgggtccagcgc
tctctcacggtctctctgaggcgtcaccaaagggacctggtggaccccagtggctggctg
tctcttgatgactccctcatctatgacaatgaaggagaccaagtcaagaatggcaccaac
atgaagtccctgaacctggagatgcaggagcccgttatagctgcttccctgtcgcaaacc
ggagcctctatcggcagcgcgttggcagctatcatgcttctcctattgctgtttctggtg
gcctgttttgtcaccaggaaatgccagaagcaaaagaagaaacagcctccggaggacact
ctggaggaataccctctgaataccaaggtggatgtagccaagagaaatgcagacaaggtg
gagaagaatgccaacagacagtactgtaccgtgcgcaatgtcaacatactgagtgacaat
gaagggtattatacgttcaaaggtgctaaagtcaaaaaactgaatctggaggtcagagtc
cacaacaatttacaagatgggacggaagtttaa

DBGET integrated database retrieval system