KEGG   Mus musculus (house mouse): 231549
Entry
231549            CDS       T01002                                 
Symbol
Lrrc8d, 2810473G09Rik, 4930525N13Rik, A930019F03, Lrrc5
Name
(RefSeq) leucine rich repeat containing 8D
  KO
K22038  volume-regulated anion channel
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    231549 (Lrrc8d)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, volume-regulated (VRAC)
   231549 (Lrrc8d)
SSDB
Motif
Pfam: Pannexin_like LRR_8 LRR_4 LRR_5 LRR_9 LRR_6
Other DBs
NCBI-GeneID: 231549
NCBI-ProteinID: NP_001116240
MGI: 1922368
Ensembl: ENSMUSG00000046079
UniProt: Q8BGR2
Position
5:105847829..105963081
AA seq 859 aa
MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPS
PANSKAHTPPGNADITTEVPRMETATHQDQNGQTTTNDVAFGTSAVTPDIPLQATHPHAE
STLPNQEAKKEKRDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVS
SNFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETACEDSEENKQRITGAQTLPKHVS
TSSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVE
DSDLIYKLYVVQTLIKTAKFIFILCYTANFVNAISFEHVCKPKVEHLTGYEVFECTHNMA
YMLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFL
LHMVDQYDQLYSKRFGVFLSEVSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFML
SGVPDAVFDLTDLDVLKLELIPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHL
RCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNL
TKVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSN
LQELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVAIPPSITHVKNLESLYFSNNKLE
SLPTAVFSLQKLRCLDVSYNNISTIPIEIGLLQNLQHLHITGNKVDILPKQLFKCVKLRT
LNLGQNCIASLPEKISQLTQLTQLELKGNCLDRLPAQLGQCRMLKKSGLVVEDQLFDTLP
LEVKEALNQDVNVPFANGI
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgtttacccttgcggaagttgcttcacttaatgacattcagccaacttaccgaatcctg
aagccatggtgggacgtgtttatggattacctggcagtcgttatgctgatggtagccatc
tttgcagggaccatgcaacttaccaaagatcaggtggtgtgtttgccagtgttgccgtcg
cctgcaaattcaaaagcgcacacaccacccggaaatgctgacatcaccaccgaagtcccc
aggatggaaacagccacacaccaagaccaaaacgggcagacgacaacgaatgacgttgcc
tttggcacatccgctgtgacccctgacatacctctccaagccacccatcctcatgcagag
tccacccttcccaatcaggaggcgaagaaggagaagagagacccaacgggccgaaaaacc
aacttggattttcagcagtacgtatttatcaatcagatgtgttaccatctggccctccct
tggtactccaagtactttccataccttgcccttatacacaccatcatccttatggtcagt
agcaacttttggttcaaatatcccaaaacgtgctccaaggttgagcattttgtttcaata
ttaggaaagtgtttcgaatctccctggacaactaaggcgctgtcagagacggcctgtgaa
gactctgaggagaacaagcagcggataacgggcgcccagaccctgccgaagcatgtgtcc
accagcagcgatgaggggagccccagcgccagcacccccatgatcaacaaaactggcttc
aagttctcggctgagaaaccggtgatcgaagttcccagcatgacaatcctggacaagaaa
gacggggagcaggccaaagccctgtttgagaaagtaaggaaattccgtgcccacgtggaa
gacagtgacttgatctataagctctatgtggtccaaacgctcatcaaaactgccaagttc
atttttatcctctgctacactgcgaactttgtcaacgccatcagcttcgagcacgtctgc
aagccaaaagtcgagcacctcacggggtacgaggtgttcgagtgcactcacaatatggcc
tacatgttgaaaaagctgctcatcagctacatctccatcatctgcgtctacggctttatc
tgcctctacactctcttctggctattcaggatccctctgaaggagtactcgtttgagaaa
gtccgggaggagagcagcttcagcgacatcccggatgtcaagaacgactttgcgttcctt
ctgcacatggtcgaccagtacgaccagctctattccaagcgtttcggtgtgttcttatcc
gaagtcagtgagaacaaactgagggaaatcagcctgaaccatgagtggactttcgagaaa
ctcaggcagcacgtgtcccgcaatgcccaggataagcaggagctgcacctcttcatgctg
tccggggtgcccgacgctgtctttgacctcacagacctggatgtgctaaaacttgaactg
atccccgaagcaaaaattcctgccaagatctctcagatgactaacctccaagagctccac
ctctgccactgccctgcaaaggtggaacagactgcctttagcttcctccgagatcacttg
agatgccttcacgtgaagttcacggatgtggctgaaatccccgcctgggtgtatctgctt
aaaaacctgcgggagctgtacttgatcggcaatttgaactcggaaaacaataagatgatc
ggcctcgagtcgctgcgagagctgcggcaccttaagatcctccacgtgaagagtaatcta
accaaagtcccctctaacatcaccgacgtggctccgcacctcacgaagctcgtcatccac
aacgacgggaccaagctcttggtcctgaacagcctgaagaagatgatgaacgtggccgag
ctcgagctgcagaactgtgagctggagaggatcccacacgccatcttcagcctctctaat
ctgcaggagctggatttaaagtcaaacaacatccggacgatcgaggagatcatcagcttc
caacatctgaagcgactgacttgcttaaagctgtggcacaataaaattgtggccatccca
ccctccattacccatgtcaagaacctggagtccctctacttctccaacaacaagctcgag
tctttaccgacggcagtgtttagtttacagaaactcagatgcttagacgtcagctataac
aacatttccacgatccccatagagataggtttgctccagaacctgcagcatttgcacatc
acagggaacaaggtggacattctgccaaaacagttgtttaagtgcgtgaagttgaggact
ttgaacctggggcagaactgtatcgcctccctgcctgagaaaatcagtcagctcacccag
ctcactcagctggagctgaagggcaactgcctagaccgcctgccagcccagctgggccag
tgtcggatgctcaagaagagcgggcttgttgtagaagaccaactgtttgacacgctgcca
ctagaagtcaaagaggcattgaatcaagatgtcaatgtcccctttgcaaacgggatttga

DBGET integrated database retrieval system