KEGG   Mus musculus (house mouse): 231580
Entry
231580            CDS       T01002                                 
Symbol
Gak, D130045N16Rik
Name
(RefSeq) cyclin G associated kinase
  KO
K08855  cyclin G-associated kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    231580 (Gak)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    231580 (Gak)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     231580 (Gak)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   231580 (Gak)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    231580 (Gak)
SSDB
Motif
Pfam: Pkinase PTEN_C2 PK_Tyr_Ser-Thr DnaJ Kinase-like Haspin_kinase Seadorna_VP7 DSPc
Other DBs
NCBI-GeneID: 231580
NCBI-ProteinID: NP_705797
MGI: 2442153
Ensembl: ENSMUSG00000062234
UniProt: Q99KY4 A0A0R4J0F6
Position
5:complement(108716973..108777643)
AA seq 1305 aa
MSLLQSALDFLAGPGSLGGAAGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDL
GSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLKRVECKGPLSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYTVFHDLIRAMLKVNP
EERLSIAEVVRQLQEIAAARNVNPKAPITELLEQNGGYGNSGPSRAQPPCGGTVNSSGVL
ALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVMSF
PAEGVESAIKNNIEDVRMFLDAKHPGHYAVYNLSPRIYRASKFHNRVTECGWAVRRAPHL
HSLYTLCRSMHAWLREDHRNVCVVHCMDGRAASAVAVCAFLCFCRLFSTAEAAVYMFSMK
RCPPGIWPSHKRYIEYVCDMVAEEPITPHSKPMLVKSVVMTPVPLFSKQRNGCRPFCEVY
VGEERVTTTSQEYDRMKEFKIEDGKAVIPLGVTVQGDVLIIIYHARATLGGRLQAKMASM
KMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAPPW
ENTSLRGLNPKILFSNREEQQDILSKFGKPELPRQPGSTAQYDAEAGSPEAEITESDSPQ
SSSTDTNHFLHTLDWQEEKEPETGLDNTSPKESQSVLIADGDGSEVSDEEEASFPSEERK
PGAGEDTPRLAAGTKQQDLIFDVGMLAAPQEPVQPEEGVDLLGLHSEGDLRPAAPLQACG
VPSSNTDLLSCLLEPSDAAQVGPPGDLLGGEAPLLLASPVSPLGLQNNLQGKVPDTVDPF
DQFLLSSNSDTQPCSKPDLFGEFLNSDSVASSTAFPSTHSAPPPSCSTAFLHLGDLPAEP
SKVIASSSHPDLLGGWDTWADTATPGPASIPVPEGTLFSSAGHPAPPGPNPSQTKSQNLD
PFADLSDLSSSLQGLPAGLPAGGFVGAPAPTQKSNSPWQANRPTAPGTSWTPQAKPAPRA
SEQLRSHFSVIGAREERGVRVPSFAQKPKVSENDFEDLLPNQGFSKSDKKGPKTMAEMRK
QELARDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVSMADLVTPEQVKKQ
YRRAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGSRPLF
NT seq 3918 nt   +upstreamnt  +downstreamnt
atgtcgctgctgcagtctgcgctggacttcctggcgggccctggttctcttggcggagct
gcgggccgtgatcagagtgacttcgtggggcagacagtggagctgggcgagctgcgtctg
cgggtgcggcgggtcctggccgagggagggtttgcttttgtttatgaagctcaagatctg
ggaagtggcagagagtatgcattaaagcgattactatccaatgaagaggaaaagaacaga
gccatcattcaggaagtttgtttcttgaaaaaactttctggccaccccaatattgtccag
ttctgctctgcagcatccataggaaaagaggagtcggacactgggcaggctgagttcctc
ctgcttacggagctttgtaaaggacagctggtggagtttctcaagagagttgaatgtaaa
ggtcctctgtcctgcgacagcattctgaagatcttctaccagacatgcagagcagtgcag
cacatgcacaggcagaaaccacccatcatccacagagatctcaaggttgaaaacttactg
cttagtaaccaggggaccattaagctgtgtgactttggcagtgccacaaccatctcccat
tatcctgactacagctggagtgcccagaagcgagccatggtggaggaagagatcacaagg
aacaccacacccatgtacagaacaccagaaattgtagacctgtattccaacttccccatt
ggcgaaaagcaggatatctgggcactgggctgtatcttatacctgctgtgtttccggcag
catccttttgaggatggagcaaaacttcggatagtcaatgggaagtattccattcctgtg
aatgacactcgttacacagtcttccatgaccttattcgtgccatgctaaaggtcaaccca
gaggagaggctgtccattgctgaagtggtccgacaactgcaggaaattgcagcagctagg
aatgtgaaccccaaagctcccatcacagagctgctggagcagaatggtggctatgggaac
tcagggccttcccgagcacaaccaccttgcgggggcaccgtgaacagcagtggagttttg
gctctggcagagtatgaccagccctacggtgggtttcttgatattctgcggggtgggacc
gaacggctcttcaccaacctcaaggatacttcctccaaggtcatccagtctgtggctaac
tatgcaaagggtgatctggacatatcttacatcacatccaggattgcagtgatgtcattc
ccagcagaaggtgtggagtctgcaatcaaaaacaatatagaggatgtgcgaatgtttctg
gatgctaagcatccaggacattatgctgtctacaacctttctccaaggatataccgggct
tccaagtttcacaaccgggtcactgagtgtggctgggcagtcagacgggcaccacatctc
cacagtttgtatactctatgtaggagcatgcatgcctggctccgggaagaccacaggaac
gtctgtgttgtgcattgcatggatgggagagctgcatctgctgtggcagtctgtgcattc
ctgtgcttctgccgtctcttcagcactgcagaggctgctgtgtacatgttcagcatgaag
cgctgcccaccaggcatttggccatcccacaaaaggtacattgaatatgtatgtgacatg
gtggcagaggagcccatcacgccccatagcaagccaatgctggtgaaatctgttgtcatg
acccccgtgccactgttcagcaagcagaggaatggctgccgaccgttctgtgaggtctac
gttggagaggagcgtgtcaccaccacgtcgcaggaatatgacagaatgaaggaatttaaa
attgaggatggcaaggctgtcatccccctgggcgtaacagttcaaggagacgtgctcatc
atcatctaccatgccagggccacactgggagggaggctgcaggctaagatggcgtccatg
aaaatgttccagatccagttccacactgggttcgtgcctcgaaacgcaaccactgtgaaa
tttgcaaaatatgacctggatgcttgtgatattcaagagaagtacccagatctgttccag
gtgaacctggaagtggaggtagagcctagagacaggcccagccgagaagctccaccttgg
gagaacaccagcctaagggggttaaaccccaagatcctcttttccaacagggaagagcag
caggacattctgtctaagtttgggaagccggagctaccccggcagccgggctccacagct
cagtatgatgctgaggcagggtctccggaggctgagatcacagagtcggactcaccgcag
agcagcagtacggacaccaaccactttcttcacacactggattggcaggaggaaaaagaa
ccagagactgggttagacaatacctctcctaaggagagtcagtctgtcctgattgcagac
ggagatggaagtgaagtatcagatgaagaagaggcttcattccccagtgaggagaggaaa
ccaggagctggagaagatacaccaaggctggctgctgggaccaaacagcaagacttaata
tttgatgtgggcatgctggctgccccacaggagcctgtacagcccgaagaaggtgttgat
ctcctggggctacactctgagggggacttaaggcctgctgcccccttacaggcttgtggg
gtcccatctagcaacactgacctgttgagctgccttcttgaaccatctgatgctgctcaa
gtagggcctcctggtgacctgcttggtggtgaggctccactgctgctagcaagcccagtt
tctcctcttgggctgcagaacaacctacaaggaaaagtccctgacactgtggacccattt
gaccagttcctgctgtcatccaactcagacacccagccctgctccaagcctgatctcttt
ggagagtttctcaactctgactctgtagcttcctcaactgccttcccatccacccacagt
gccccacccccatcctgtagcactgccttcctgcacctaggggatctgccagcagagccc
agcaaggtaatagcttcatccagccacccagatctgctaggaggatgggatacgtgggct
gacacagctacacctgggccagcctccattccagtaccagaaggtaccctcttctcttct
gcaggtcacccagcccctcctggccccaaccccagccaaaccaagtctcagaaccttgac
ccatttgctgatctcagtgatctcagctctagcctccaaggcctgcctgctggacttcct
gcagggggctttgttggcgcaccagcccccactcaaaagagcaacagcccctggcaggca
aatcgtcccacagcccctggaacctcatggaccccccaggccaagccagcccccagagcc
tctgaacagctaaggtctcacttcagtgtgatcggggcccgagaagagaggggcgtccgt
gtgcccagctttgcccaaaagccaaaggtctcagaaaatgattttgaagatcttctgcct
aatcaaggcttctctaagtctgacaagaaggggccaaagaccatggcagagatgcggaaa
caggaacttgccagagatacagacccactcaaattgaagcttttggactggattgaaggc
aaggagaggaacattcgtgcactgctgtccactctgcacacggtattgtgggatggggag
agccgctggacacctgtgagtatggctgacctggtgactccagagcaggtgaagaagcag
taccgccgtgcagtgctggtagtgcatcctgataaggccacagggcagccgtatgaacag
tatgccaagatgatcttcatggagctgaatgatgcatggtctgagtttgaaaaccagggc
tcgaggcccctcttctga

DBGET integrated database retrieval system