KEGG   Mus musculus (mouse): 231591Help
Entry
231591            CDS       T01002                                 

Gene name
Vmn2r14, EG231591
Definition
(RefSeq) vomeronasal 2, receptor 14
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    231591 (Vmn2r14)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    231591 (Vmn2r14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor NCD3G STAS PBSX_XtrA
Motif
Other DBs
NCBI-GeneID: 231591
NCBI-ProteinID: NP_001098095
MGI: 3649151
Ensembl: ENSMUSG00000091059
Vega: OTTMUSG00000039863
UniProt: E9Q759
Position
5; 5 F
AA seq 848 aa AA seqDB search
MKNLRGFGLSFMLLKFSLIWCHLTEPICFWRIKNNEDNDGDLRSDCGFFLAAVEGPIDHT
YNISDFRIPARRHEFFLVLFFATDEINKNPYLLPNMSLIFPEDPGQCEKLLGELDKIHSE
AKFTVDFTDYICAGYGTCYIGLIGPSWKTSVKLSTNSGTPRVFFGPFNPKLSDHDQFPYV
HQVATKDTHLSHGMITLMLHFRWTWIGLVISDDDQGIQFLSDLREEMQRHGICLAFVNMI
PEDMQLYMTRAKIYDKQIMESTAKVVIIYGEMNSTLEVSFRRWEDLGARRIWITTSQWDV
ITNKNDFSLDFFHGTVTFEYHHSEIAKFKNFMKTMNTDKYPVNISESILRWNYFNCSTSM
NSYSKMGHFTFNNTLEWTALHNFDMALSEEGYNLYNAVYAVAHTYHELILLQVESQQTEE
PKGTFTDCQQVSSTLKSRIFTNPVGELVNMKHRENQCADYDIFIIWNFPQGLGLKVKIGS
YLPCFPQSQQLHISEDLDWATGGSSVPSSLCSVTCTAGFRKIHQKQTADCCFDCDQCPEN
AVSNETADMEQCVRCPDDKYANLEKTHCLQRAVSFLAYEDPLGMALGCMALTFSALTVLV
LVTFVKYKDTPIVKANNRILSNILLISLVFCFLCPLLFIGHPNKATCILQQTTFGVFFTV
AISTVLAKTITVLMAFKLTSPGGKMRGMLASGAPNLVIPICTLVQLVLCGIWLVTSPPFI
DRDTQSEHGKTIIICNKGSVIAFHFVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGTVMVVVEVFSILASSAGLLGCIFVPKCFVILVRPDSNFLQ
KYKDKLFY
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacctgcgtggttttggtctttcctttatgctcctgaagttttctctcatctgg
tgccatttgactgaacccatttgcttttggaggataaagaataatgaagataatgatgga
gatttgagaagtgactgtggttttttccttgcagcagttgagggacctattgaccacact
tataatatctctgattttagaataccagcaagaagacatgagtttttcctagtactgttt
tttgctactgatgaaatcaacaagaatccttatcttttacccaacatgtctttgatattc
cctgaagatcctggtcagtgtgaaaaactattgggagaactggataaaatacattcagaa
gcaaaatttactgtggattttactgattatatatgtgcaggttatggaacctgttacata
ggccttataggaccatcatggaaaacatctgtaaaactctcaacaaattctgggacacca
agggttttctttggaccatttaatcctaaactgagtgaccatgaccagtttccctatgtc
catcaggtagccaccaaggacacacatttgtcccatggcatgatcactttgatgcttcat
tttagatggacttggataggactggtcatctcagatgatgaccaaggtattcagtttcta
tcagacttgagagaagaaatgcaaagacatggaatctgtttagcttttgttaatatgatc
ccagaagacatgcagttatacatgacaagggctaagatatatgataaacaaattatggaa
tcaacagcaaaggttgttatcatttatggtgaaatgaactctaccctagaagtcagcttt
agaaggtgggaagatttaggcgcaaggagaatctggatcacaacctcacaatgggatgtt
atcacaaataaaaatgattttagccttgatttctttcacgggactgtcacttttgaatac
caccacagtgagattgctaaatttaagaattttatgaaaacaatgaacactgacaaatat
ccagtaaacatttctgagtctatactgcggtggaattactttaattgttcaacctcaatg
aacagctatagcaaaatgggtcattttacattcaacaacacattggaatggacagcactg
cacaattttgacatggccctgagtgaggaaggctacaatttgtataatgctgtgtatgct
gtggcccacacctaccatgaactcattcttctacaagtagaatctcagcaaacagaagaa
cccaaaggaacattcactgactgtcagcaggtgtcttccacactgaaatccaggatattt
actaaccctgttggagaactggtgaacatgaagcatagggaaaatcagtgtgcagattat
gacattttcatcatttggaattttccacaaggccttggattaaaagtgaaaatcggaagc
tatttgccttgtttcccacagagccaacaacttcatatatctgaagacttggactgggcc
acaggaggatcatcagttccctcctccctgtgtagtgtaacatgtactgctggattcagg
aaaattcatcagaaacaaacagcagattgctgctttgattgtgatcagtgcccagaaaat
gcagtttccaatgaaacagcagatatggaacagtgtgtgaggtgtccagatgataagtat
gccaacttagagaaaacccactgcctccaaagagctgtgtcattcctggcttatgaagat
ccattggggatggctctaggatgcatggccctgaccttctctgccctcacagttctagta
ctagtcacttttgtgaagtacaaggatactcccattgtgaaggccaataaccgcattctc
agcaacatcctgctcatctctctagtcttctgttttctctgcccattgctcttcattgga
catcccaacaaggccacctgcatcctgcagcagaccacatttggagtatttttcacagtg
gctatttctacagtgttggctaaaacaataactgtgctcatggctttcaagctcacttct
ccagggggaaagatgagagggatgctggcatcaggggcacctaacttggtcattccaatt
tgtaccctagtccaacttgttctctgtggaatctggttagtaacatctcctccctttatt
gacagagatacacaatctgaacatggaaagaccatcattatttgcaacaaaggctcagtc
attgccttccattttgttctgggatacttgggttccttggctctggggagcttcactgtg
gctttcttggctaggaaccttcctgacagattcaatgaagccaagttcctaacattcagc
atgctggtattctgcagtgtctggatcaccttcctccctgtctaccacagcaccagggga
acagtcatggtggttgtggaggttttctccatcttggcttctagtgcaggcttgctaggg
tgtatctttgtcccaaagtgttttgttattttagttagaccagattcaaactttctgcag
aaatacaaggataaattgttttactga

DBGET integrated database retrieval system