KEGG   Mus musculus (mouse): 231602
Entry
231602            CDS       T01002                                 

Gene name
P2rx2, P2X2a, P2x, P2x2
Definition
(RefSeq) purinergic receptor P2X, ligand-gated ion channel, 2
  KO
K05216  P2X purinoceptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    231602 (P2rx2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    231602 (P2rx2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    231602 (P2rx2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    231602 (P2rx2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   231602 (P2rx2)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 231602
NCBI-ProteinID: NP_700449
MGI: 2665170
Ensembl: ENSMUSG00000029503
Vega: OTTMUSG00000054126
UniProt: Q8K3P1
Position
5; 5 F
AA seq 485 aa
MAAAQPRLPAGAAMVRRLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWY
VFIVQKSYQDSETGPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPS
QTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVE
DGTSENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYLKHCTFDQDSDPYCPIF
RLGFIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGY
NFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFL
CDWILLTFMNKNKLYSHKKFDKVRTPRHPSSRWPVTLALVLGQIPPPPSHYSQDQPPSLP
SGEGPALGEGAELPLAVQPPRSCSSSALTEQVVDTLDQHMGQRPPVPEPSQQDSTSTDPK
GLAQL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggccgctgcacagccccggcttcccgcgggggcggccatggtccggcgcttggcccgg
ggctgctggtccgcgttctgggactacgagacgcccaaggtgatcgtggtgcggaatcgg
cgcctgggattcgtgcaccgcatggtgcagctgctcattctgctttacttcgtgtggtac
gtcttcatcgtgcagaaaagctaccaggatagcgaaaccggtccggagagctccatcatc
accaaagtcaaggggatcaccatgtcggaacacaaagtgtgggacgtggaggaatacgta
aagcccccggaggggggcagtgtagtcagcatcatcaccaggatcgaggttactccttcc
cagaccctgggaacatgcccagagagcatgagggttcacagctctacctgccatttagat
gacgactgtgtggccggacagctggacatgcagggcaatgggattcggacaggacgctgt
gtaccctattaccatggggactccaagacctgcgaggtgtcagcctggtgcccggtggag
gatgggacttctgaaaaccattttctgggtaaaatggccccaaatttcaccatcctcatc
aagaacagcatccactatcccaagttcaagttctccaagggcaacattgcaagccagaag
agtgactacctgaagcactgcacgtttgatcaggactctgatccatactgtcccatcttc
aggctgggcttcattgtagagcaagcaggagagaacttcacagaactggcacacaagggc
ggtgtcattggggtcatcatcaactggaactgtgacctggacttgtctgaatcagagtgc
aaccccaaatattctttccggaggctcgaccccaagtatgaccctgcctcttcaggctac
aacttcaggtttgccaaatattacaagataaacggcaccaccaccactcgaactctcatc
aaagcctatgggattcgaattgacgttattgtgcatggacaggcagggaaattcagtctc
attcccaccatcatcaatctggccactgctctgacctccatcggggtgggctcctttctg
tgtgactggattttgttaacgttcatgaacaaaaacaagctctacagccataagaagttc
gacaaggtgcgtaccccaaggcacccctcaagtagatggcctgtgacccttgcccttgtc
ttgggccagatccctcccccacctagtcactactcccaggaccagccacccagccttcca
tcaggtgaaggaccagctttgggagaaggggcagagctaccactggctgtccagcctcct
cggtcttgctccagctctgctctgactgagcaggtggtggacactcttgaccagcatatg
ggacaaaggcctcctgtccctgagccttcccaacaggactccacatccacggaccccaaa
ggtttggcccaactttga

DBGET integrated database retrieval system