KEGG   Mus musculus (mouse): 231642
Entry
231642            CDS       T01002                                 

Symbol
Alkbh2, 9530023G02, AU016977, Abh2, mABH2
Name
(RefSeq) alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
  KO
K10859  DNA oxidative demethylase [EC:1.14.11.33]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    231642 (Alkbh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.33  DNA oxidative demethylase
     231642 (Alkbh2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    231642 (Alkbh2)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 231642
NCBI-ProteinID: NP_778181
MGI: 2141032
Ensembl: ENSMUSG00000044339
Vega: OTTMUSG00000014449
UniProt: Q6P6J4
Position
5:complement(114261987..114269293)
AA seq 239 aa
MDKFLVRPDLRDLQGGGEEPAPTGGASGDLKSPDWRHLRAEGLSCDYTVLFGKAEADKIF
RELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWVPVLERVR
DRVCEVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFIFRHKDS
RGKRPRRTVEVVRLQLAHGSLLMMNPPTNTHWYHSLPIRKRVLAPRVNLTFRKILPTKK
NT seq 720 nt   +upstreamnt  +downstreamnt
atggacaagttcctggtgaggccagacctccgcgacctccaagggggaggggaggagccc
gccccgacgggaggagcctcgggcgacctgaagagcccggactggcgacaccttcgcgcg
gaaggtctgagctgtgattacaccgtcctattcggcaaagccgaggcagacaagattttc
cgagagttggagcaagaagtggagtattttactggtgcactggccaaggtccaggtgttc
ggaaagtggcacagtgttcccaggaagcaggcgacctatggcgatgctggcctcacgtac
acgttttctggtcttaccctgacaccaaagccctgggttcctgttctagagcgtgttcga
gatcgagtctgcgaggtgacaggacagaccttcaactttgtactcgtgaacaggtacaaa
gatggttgcgaccacatcggcgagcacagagatgacgagcgagaactggctccggggagc
cccatcgcgtctgtctcctttggcgcttgcagagacttcattttccggcacaaagactct
cgagggaagaggccccggaggacagtggaggtggtcaggctgcagctggcacacggaagc
ctgctgatgatgaaccccccaaccaacacccactggtaccacagtctccccatccgcaag
agggtcctggctccgcgggtcaacttgacttttcggaaaattttacctactaagaaataa

DBGET integrated database retrieval system