KEGG   Mus musculus (mouse): 231659
Entry
231659            CDS       T01002                                 

Gene name
Gcn1, 4932409G22, AL022764, G431004K08Rik, GCN, GCN1L, Gcn1l1, mKIAA0219
Definition
(RefSeq) GCN1 activator of EIF2AK4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HEAT HEAT_2 HEAT_EZ CLASP_N Cnd1 Vac14_Fab1_bd UME MMS19_C Adaptin_N DUF3535 MMS19_N TFCD_C CAAP1 IL34
Other DBs
NCBI-GeneID: 231659
NCBI-ProteinID: NP_766307
MGI: 2444248
Ensembl: ENSMUSG00000041638
Vega: OTTMUSG00000014702
UniProt: E9PVA8 Q3UHQ5 Q8BTM7 Q8BIX2
Position
5; 5 F
AA seq 2671 aa
MAADTQVSETLKRFAVKVTTASVKERREILSELGRCIAGKDLPEGAVKGLCKLFCLTLHR
YRDAASRRALQAAIQQLAEAQPEATAKNLLHSLQSSGVGSKACVPSKSSGSAALLALTWT
CLLVRIVFPLKAKRQGDIWNKLVEVQCLLLLEVLGGSHKHAVDGAVKKLTKLWKENPGLV
EQYFSAILSLEPSQNYAAMLGLLVQFCTNHKEMDAVSQHKSTLLEFYVKNILMSKAKPPK
YLLDNCAPLLRFMSHSEFKDLILPTIQKSLLRSPENVIETISSLLASVTLDLSQYALDIV
KGLANQLKSNSPRLMDEAVLALRNLARQCSDSSATEALTKHLFAILGGSEGKLTIIAQKM
SVLSGIGSLSHHVVSGPSGQVLNGCVAELFIPFLQQEVHEGTLVHAVSILALWCNRFTTE
VPKKLTDWFKKVFSLKTSTSAVRHAYLQCMLASFRGDTLLQALDFLPLLMQTVEKAASQG
TQVPTVTEGVAAALLLSKLSVADAQAEAKLSGFWQLVVDEKRQTFTSEKFLLLASEDALC
TVLRLTERLFLDHPHRLTNSKVQQYYRVLVAVLLSRTWHVRRQAQQTVRKLLSSLGGVKL
ANGLLDELKTVLNSHKVLPLEALVTDAGEVTEMGKTYVPPRVLQEALCVISGVPGLKGDI
PSTEQLAQEMLIISHHPSLVAVQSGLWPALLTRMKIDPDAFITRHLDQIIPRITTQSPLN
QSSMNAMGSLSVLSPDRVLPQLISTITASVQNPALCLVTREEFSIMQTPAGELFDKSIIQ
SAQQDSIKKANMKRENKAYSFKEQIIEMELKEEIKKKKGIKEEVQLTSKQKEMLQAQMDK
EAQIRRRLQELDGELEAALGLLDAIMARNPCGLIQYIPVLVDAFLPLLKSPLAAPRVKGP
FLSLAACVMPPRLKTLGTLVSHVTLRLLKPECALDKSWCQEELPVAVRRAVSLLHTHTIP
SRVGKGEPDAAPLSAPAFSLVFPMLKMVLTEMPYHSEEEEEQMAQILQILTVHAQLRASP
DTPPERVDENGPELLPRVAMLRLLTWVIGTGSPRLQVLASDTLTALCASSSGEDGCAFAE
QEEVDVLLAALQSPCASVRETALRGLMELRLVLPSPDTDEKSGLSLLRRLWVIKFDKEDE
IRKLAERLWSTMGLDLQSDLCSLLIDDVIYHEAAVRQAGAEALSQAVARYQRQAAEVMGR
LMEIYQEKLYRPPPVLDALGRVISESPPDQWEARCGLALALNKLSQYLDSSQVKPLFQFF
VPDALNDRNPDVRKCMLDAALATLNAHGKENVNSLLPVFEEFLKDAPNDASYDAVRQSVV
VLMGSLAKHLDKSDPKVKPIVAKLIAALSTPSQQVQESVASCLPPLVPAVKEDAGGMIQR
LMQQLLESDKYAERKGAAYGLAGLVKGLGILSLKQQEMMAALTDAIQDKKNFRRREGALF
AFEMLCTMLGKLFEPYVVHVLPHLLLCFGDGNQYVREAADDCAKAVMSNLSAHGVKLVLP
SLLAALEEESWRTKAGSVELLGAMAYCAPKQLSSCLPNIVPKLTEVLTDSHVKVQKAGQQ
ALRQIGSVIRNPEILAIAPVLLDALTDPSRKTQKCLQTLLDTKFVHFIDAPSLALIMPIV
QRAFQDRSTDTRKMAAQIIGNMYSLTDQKDLAPYLPSVTPGLKASLLDPVPEVRTVSAKA
LGAMVKGMGESCFEDLLPWLMETLTYEQSSVDRSGAAQGLAEVMAGLGVEKLEKLMPEIV
ATASKVDIAPHVRDGYIMMFNYLPITFGDKFTPYVGPIIPCILKALADENEFVRDTALRA
GQRVISMYAETAIALLLPQLEQGLFDDLWRIRFSSVQLLGDLLFHISGVTGKMTTETASE
DDNFGTAQSNKAIITALGVDRRNRVLAGLYMGRSDTQLVVRQASLHVWKIVVSNTPRTLR
EILPTLFGLLLGFLASTCADKRTIAARTLGDLVRKLGEKILPEIIPILEEGLRSQKSDER
QGVCIGLSEIMKSTSRDAVLFFSESLVPTARKALCDPLEEVREAAAKTFEQLHSTIGHQA
LEDILPFLLKQLDDEEVSEFALDGLKQVMAVKSRVVLPYLVPKLTTPPVNTRVLAFLSSV
AGDALTRHLGVILPAVMLALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEAT
RSPEVGMRQAAAIILNMYCSRSKADYSSHLRSLVSGLIRLFNDSSPVVLEESWDALNAIT
KKLDAGNQLALIEELHKEIRFIGNECKGEHVPGFCLPKRGVTSILPVLREGVLTGSPEQK
EEAAKGLGLVIRLTSADALRPSVVSITGPLIRILGDRFNWTVKAALLETLSLLLGKVGIA
LKPFLPQLQTTFTKALQDSNRGVRLKAADALGKLISIHVKVDPLFTELLNGIRAVEDPGI
RDTMLQALRFVIQGAGSKVDAAIRKNLVSLLLSMLGHDEDNTRISTAGCLGELCAFLTDE
ELNTVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPSRLCAGRYSNEVQDMILSNAVAD
RIPIAMSGIRGMGFLMKYHIETGSGQLPPRLSSLLIKCLQNPCSDIRLVAEKMIWWANKE
PRPPLEPQTIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRRGEELLQSLSKILDVAS
LEALNECSRRSLRKLACQADSVEQVDDTILT
NT seq 8016 nt   +upstreamnt  +downstreamnt
atggcggcggacacgcaggtttccgagacactgaagcgcttcgctgtgaaggtgacaaca
gccagtgtgaaggagcggagagagattctcagtgaactggggcgatgcatcgccggcaaa
gatctgccagagggagccgtgaaagggctctgcaagttgttctgcttgacactgcatcga
tatagagacgcagcctctcgcagagccctgcaggcagccatccagcagctggccgaggcc
cagccagaggccaccgccaagaacctcctgcactctctccagtcttcaggggttggctcc
aaagcatgtgttcccagcaagagtagcggctcagctgccttgctggctctgacctggacc
tgcctcctagtgcgaattgtctttcccctgaaggccaagcggcaaggagacatctggaac
aagctggtggaggtgcagtgcctgctgctgctggaggtgctgggcggctcccacaagcat
gctgtggacggtgctgtgaagaagctcactaagctatggaaggagaaccctgggctggtg
gagcagtacttctcagccatccttagcctggagcccagccaaaactatgctgccatgctg
gggctgctggtgcagttctgcacgaaccacaaagagatggacgcggtcagccagcataag
agcaccctgctggagttctacgtgaagaacattctgatgagcaaagccaagcctcccaag
tacttgctggacaactgtgcccccttgctccggttcatgtcccactcagagtttaaggat
ctgattctgcccaccatacagaagtccttgctgaggagcccagagaatgttattgaaact
atctccagcctgctggcttcagtgacactcgatctcagccagtacgccctggacatcgtg
aaaggcttggcaaatcagctgaagtccaacagcccccgcctgatggatgaagcggtcctg
gcgcttcgcaacctggcccgccagtgcagtgactcctccgccactgaggccctgaccaag
cacctgtttgcgatccttggaggctcagaaggaaagctaaccatcatagcccagaagatg
agtgtcctttcagggattggaagcctcagtcatcacgtggtatcggggccgtcgggtcaa
gtcctgaatggctgtgtggctgagctgttcatccccttcctgcagcaggaagtgcacgaa
ggtaccttggtacacgccgtctccatcctggcgctctggtgcaaccggttcactacagaa
gtgcccaagaagcttacggactggttcaagaaagtcttcagccttaaaacgtccacctct
gcagtgcggcacgcctacctgcagtgcatgctggcctccttccgaggtgacacactgttg
caggccttggactttctgccattgcttatgcagacagtagagaaggcggcctcccagggc
actcaggtccccacagtcaccgaaggggtcgccgcagcccttctgctctccaagctgtct
gtggctgacgcccaggccgaggccaagctgagcggcttttggcagctggttgtggatgag
aagaggcagactttcacgtctgagaagttcctgctcctggcttcagaggacgccctgtgc
actgtgctgcgtctgacggagaggcttttccttgaccaccctcacaggctcaccaacagc
aaagtccagcagtactatcgggtcctggtggctgtgctcctgagccggacctggcatgtg
cgcaggcaggcccagcagacagttcggaagctgctgtcctctcttgggggtgttaagctg
gccaatggtctcttggacgaactgaagactgtcctcaactctcacaaggtgcttcccttg
gaggctcttgtgacggacgctggggaggtaacggagatgggcaagacctatgtgcctcct
cgagttctgcaggaagctctgtgtgtcatctctggggtgccagggctcaagggcgacatc
cccagcactgagcagctggctcaggagatgctaatcatctcccaccacccgtccttagtg
gcagtacagtctggactctggccagcacttcttacaaggatgaagattgaccctgacgcc
ttcatcaccaggcacctggatcagatcatccccaggatcacgacacagagtcccctgaac
cagtcttccatgaacgccatgggctccctttctgtcctgtctcctgaccgcgtcctccct
cagctcatcagcaccatcactgcctctgtgcagaatcctgccctgtgccttgtgactcgg
gaggagttctccatcatgcagacccctgccggggagctgtttgataaatccatcatccag
agtgcccagcaggacagcataaaaaaggccaacatgaagcgcgagaacaaggcctactct
tttaaggagcagatcatcgagatggagctgaaggaggaaataaagaaaaagaaaggcata
aaagaggaggtacagctgaccagcaagcagaaggagatgctgcaagcccagatggacaag
gaggcacaaatccggaggcggctgcaggagctggacggggaactagaggcggcacttgga
ctactagatgccatcatggccaggaacccgtgtggcctgattcagtacatccctgtcctg
gttgatgccttcctgcccttgctgaagtctcccctggctgctcccagggtcaaaggcccc
tttctgtccttagctgcctgtgtcatgcccccgagactcaagaccttgggcaccttggtg
agtcatgtgaccctgcgcctgctgaagccagagtgtgctctggataagtcctggtgccag
gaggagctgcctgtggctgtcaggagggcggtgtcgctgttgcatacacacaccatcccc
agcagggtgggcaagggcgagccagatgccgccccgctgtctgcaccggccttctccttg
gtcttccccatgttaaagatggtgctcactgagatgccctaccacagcgaggaggaggag
gagcagatggcccagatccttcagatcctcactgtccatgcccagctgagggcgtcccct
gacaccccacctgagcgggtggacgagaatggcccggagttgctgcctcgagtggccatg
ctgcgcctgctgacgtgggtgatcgggacgggctcccctcgcctacaggttcttgcctca
gacacgctgactgccctgtgtgccagcagcagcggggaggacggctgtgccttcgcagag
caggaggaggtggacgtgctgcttgctgccctgcagtccccatgtgccagcgttcgcgag
acagcgctccggggcctgatggagctccgcctagtactgccatcacccgacactgacgag
aagagtggcctgagcctgttgcggagactctgggtcattaagttcgacaaggaggatgag
atacggaagctggccgaaaggctttggtcaaccatgggcctcgatctgcagtcagatctc
tgctctttgctgatcgatgacgtgatctatcacgaggcagccgtgaggcaggccggggct
gaagccctttcccaggcggtggcacggtaccagcggcaggcagcggaggttatgggcagg
ctcatggagatctaccaggagaagctctatcggccacccccagtgctggatgctttggga
cgagtgatttcagaatcccctcctgaccagtgggaagccaggtgtggcctagccttggcc
ctgaacaagctctcgcagtacttggatagctctcaggtgaagccgcttttccagttcttt
gtcccggatgccctgaatgaccggaacccagatgtgcggaagtgcatgttagatgcagcg
ctcgcgacgctcaatgcccatgggaaggagaatgtcaactcactgctgccagtgtttgag
gagttcctgaaggacgcacccaatgatgccagctacgacgctgtgcggcagagcgtggtg
gtcctcatggggtctctggccaaacacctggacaagagtgaccccaaagttaaacctatt
gttgccaaactcattgccgccctctccacaccctctcagcaggtccaggagtctgtggcc
agctgcctgccacctctcgtgcctgctgtcaaggaggatgctgggggcatgatccagcgg
ctcatgcagcagctgttggagtcggacaagtatgcggagcgcaaaggggcggcatacggg
ctggcgggcctggtcaagggcctgggcatcctctccctgaagcagcaggagatgatggcc
gcgctgactgatgctatccaggacaagaagaacttccgaaggcgagagggagcgctgttt
gccttcgagatgctctgtaccatgctggggaagctcttcgagccttatgtggtccacgtg
ctgccccatctgttgctgtgctttggggatgggaaccagtacgtgcgcgaggctgcagat
gactgtgccaaagctgtgatgagcaatttgagtgctcacggtgtgaagttggtgctcccg
tccttgttagctgccctggaggaggagtcctggaggaccaaagctgggtccgtagagctg
ctcggggcaatggcgtactgtgcacctaagcagctgtcgtcctgcctgcccaacattgtg
cccaagctcacagaagtgctgacagactcccacgtcaaagtgcagaaggctggacagcag
gccctcaggcagattggctctgtcatcagaaacccggagattctcgccattgccccggtc
ctgctggatgccctgacagacccatcacggaagacccagaagtgcctgcagaccctgctg
gacaccaagtttgttcacttcattgatgccccgtccctggcgctcatcatgcccattgtc
cagagagccttccaggaccgctccacagacacacgaaagatggcagcgcagattattggc
aacatgtactccctgacagaccagaaggacttggctccttacctgcccagtgtgacacct
ggcctgaaagcttcactcttggaccctgtccctgaggtgcgcaccgtgtctgcaaaggct
cttggggccatggtgaagggcatgggggagtcgtgctttgaagatttgctgccatggctg
atggagactctgacgtacgagcagagctccgtggatcgctcaggcgctgcccaagggttg
gctgaggtaatggccggcttaggagtggagaagttggaaaaactgatgccagagatcgtg
gccacagccagcaaagtggacatcgcaccccacgtccgcgacggctacatcatgatgttc
aactacctgcccatcacctttggggacaagtttaccccttatgtggggcccatcatccct
tgtatcctcaaggctctggctgatgagaacgagttcgttcgtgacaccgccctgcgtgcc
ggccagcgggtcatctcgatgtacgctgagacagctattgccctgctgctgccacagcta
gagcaaggcctctttgatgacctctggagaatacggttcagctctgttcaacttcttggg
gacctcctgttccacatctctggggtcacagggaagatgaccacggaaacagcgtctgag
gatgataacttcggaactgctcagtctaacaaggcaatcatcactgccctgggggttgac
cggcggaaccgggtcctggcgggactctacatgggccgctcagacacccagctggtggtg
aggcaggcgtcgctgcacgtgtggaagattgtcgtctccaacactccccgcaccctgcga
gagatcctgcccactctctttggcctcctactgggtttcctggctagcacgtgtgcagat
aagagaacgatcgcagcgaggacgctgggcgacctcgtccgcaagctcggggagaagatc
cttcctgagatcatccccatcctggaagaaggactaaggtcgcagaagagcgacgagagg
cagggcgtgtgcatcgggctcagcgagatcatgaagtccaccagccgggacgctgtgctc
ttcttctctgagtcccttgtgcccacggcaaggaaggcgctgtgtgatcccctggaggag
gtccgggaggcggcagccaagacctttgagcagctgcactccaccattggccaccaggct
ttggaggacattctcccgttcctactgaagcagctggacgacgaggaggtgtcggaattt
gccctggacggtctgaagcaggttatggccgttaagagccgtgtggtgctgccctatctg
gtgcccaagctgacaacaccacccgtcaatacccgggtgctggctttcctgtcctctgtg
gctggcgatgctctgacccgacaccttggcgtgatcctcccagctgtcatgttagcactg
aaggagaagcttgggactccagacgagcagctggagatggccaactgtcaggctgtgatc
ctctcagtggaggatgacactgggcaccggatcatcatcgaggatctgttggaagccacg
cgcagccctgaagtgggcatgaggcaggcggcggccatcatcctgaacatgtactgctcc
cgctccaaggccgactacagcagccaccttcgcagcctggtctcgggcttgatccgcctc
ttcaatgactccagccctgtggttctggaggagagctgggacgctctcaatgccatcacc
aagaagctggacgctggtaaccagctggccctgatcgaagaactccacaaggaaatccgc
ttcataggcaacgaatgcaaaggggagcacgtgccaggcttctgtcttccaaagagggga
gtaacctccatccttccagtgctgcgggaaggggtcctcactggcagtcctgagcagaag
gaagaagcagccaagggcttgggcttggtgatccgcctgacctcagctgatgccctgagg
ccctctgtggtcagcatcactggccctctgattcgcatccttggggaccggttcaactgg
actgtgaaggcggctctgctggagacactcagcctcttgctgggcaaggttgggattgcc
ctgaagcccttcctgccccagcttcagaccaccttcaccaaagccctacaggactccaat
cggggcgtccggctgaaggcggccgatgctctggggaagctcatttccatccacgtcaag
gtggaccccctctttacagagctgctcaacggcatccgcgcggtggaggacccgggcata
cgagacaccatgttgcaggccctgaggtttgtgattcagggtgcaggctccaaagtggat
gctgccattcggaaaaacctggtctcgctcctgctgagcatgctgggccatgacgaggac
aacactcggatctccacagctgggtgccttggggaactgtgtgcctttctgactgacgaa
gagctcaacactgtccttcagcagtgcctgctagctgacgtatctggcattgactggatg
gttcggcacggccggagcttggcgctgtccgtggctgtgaatgtggctcccagcagactg
tgtgcaggcagatacagcaatgaggttcaggacatgatcctcagcaacgccgtggcagac
aggatccccatcgccatgagtgggattcgaggcatgggcttcctcatgaagtatcacatc
gagacaggaagcgggcagctgccccccaggctctccagccttctcatcaagtgtctgcag
aacccatgtagtgacatcaggctggtggccgagaagatgatctggtgggcaaacaaggag
ccccggccccccctggagccacagaccatcaagcccatcctgaaggctcttctcgataac
accaaggacaagaacactgtcgtgcgggcctacagcgaccaggccatcgtgaacctgctc
aagatgaggcggggcgaggagctgctccagtccctctccaagatcctggacgtggccagc
ctggaggctctgaatgaatgcagccggaggtcgctgaggaagctggcctgccaggcagac
tcggtggagcaggtggacgacaccatcctgacgtga

DBGET integrated database retrieval system