KEGG   Mus musculus (mouse): 231724
Entry
231724            CDS       T01002                                 

Gene name
Rad9b, A630082N15Rik, BC021784
Definition
(RefSeq) RAD9 checkpoint clamp component B
  KO
K10995  cell cycle checkpoint control protein RAD9B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    231724 (Rad9b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    231724 (Rad9b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    231724 (Rad9b)
SSDB
Motif
Pfam: Rad9 MSA-2c
Other DBs
NCBI-GeneID: 231724
NCBI-ProteinID: NP_659161
MGI: 2385231
Ensembl: ENSMUSG00000038569
Vega: OTTMUSG00000026685
UniProt: Q6WBX7 Q8VC54
Position
5; 5 F
AA seq 403 aa
MLKCGMTGGQVKVFGKAVQTLSRVSDELWLDPSEKGLALRSVNSCHSTYGYVLFSSMFFQ
HYQWSPFATMSDTDLPLNLNCKLAIKSVLPIFRCLNYLERSVEKCTVVARADKCRVVIQF
FGKHGIKRTHNVYFQDSQPLKIIFEKSLCANILMIKPRLLTEAIALLTSNQEEVTFSVTP
GNFCLKSLSGELLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHA
PLAIYFDFPGKPVVLSVEDMLLEANFILATLVDYPSRTSSPQLLPLSQARRSHPIQSSAP
EDKSRVSQTPESISRAAPKRLFPKDSPDSSSAAETKRASAGQDDIFEVPESVVSDMEEER
SPSHLRKFSCMFFGAVSCEQQEYAGHPLDSLAVASDSEEDVSG
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgctgaagtgcgggatgacgggcggccaggtgaaagtatttgggaaagcagtacaaacg
ctatcacgagtgagcgatgagctgtggctagacccatccgagaaaggtcttgctctgaga
tctgtgaattcttgtcattccacgtatggctacgtcctgttttcatctatgttttttcaa
cattatcagtggtcaccctttgccacgatgagtgatactgacttaccactgaatttaaat
tgcaaattggcaataaagtcagttctgccaatctttagatgtctgaattaccttgaaaga
agtgtggagaagtgcacagtagtcgccagagcggataaatgcagagtcgtcattcagttc
ttcggcaagcatggtattaaaagaactcacaatgtgtatttccaagacagccagcccttg
aaaattatcttcgaaaagagtctgtgtgcgaatatcctgatgattaaaccaagactgctg
actgaggccattgctcttctgacatcaaatcaagaggaagtcaccttctctgttactcca
gggaacttttgcctcaagagtttgagtggggaattgctggatttgaccagctctgtgtac
agtgagatgtcttttggcccggaagagtttgacttctttcaggttggacttgataccgag
ataacattttgctttaaagaactgaaggggatcctcaccttctcagaagtgatgcacgca
cctctagccatctactttgactttcctggaaaaccggttgttttgagtgttgaagacatg
ctcttggaagcaaactttatcttggccacgttagtggattatccgagtagaacatcttca
ccacagttactgcccctttcccaggcacgaaggtcacaccccatacagtccagtgccccg
gaggataaaagcagagtcagtcagaccccagagagcatctctcgagcagcgcccaaaaga
ctatttcccaaggattctcctgacagcagctctgcagctgaaaccaagagagccagcgcc
ggccaggatgacatcttcgaagtgcctgaaagtgttgttagtgacatggaggaagagcgg
agcccttcacacctcaggaagttttcctgcatgttctttggagctgtatcttgtgaacag
caagagtatgccggccaccccttggacagcctggcagtagcaagcgacagtgaggaggac
gtgagtggctga

DBGET integrated database retrieval system