KEGG   Mus musculus (mouse): 231727
Entry
231727            CDS       T01002                                 

Symbol
B3gnt4, 1010001G17Rik, BGnT-4
Name
(RefSeq) UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
  KO
K07971  beta-1,3-N-acetylglucosaminyltransferase 4 [EC:2.4.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    231727 (B3gnt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    231727 (B3gnt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     231727 (B3gnt4)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   231727 (B3gnt4)
SSDB
Motif
Pfam: Galactosyl_T Fringe DUF604
Other DBs
NCBI-GeneID: 231727
NCBI-ProteinID: NP_941013
MGI: 2680208
Ensembl: ENSMUSG00000029431
Vega: OTTMUSG00000025926
UniProt: Q1RLK6
Position
5:123646519..123649945
AA seq 350 aa
MLPRLGCVLFCSLVVLLLSCLLLLKERIPAGSSKAHQQFLALPRSHHSQCSPNLTVVNTS
LSLPSRHRLFLTYRHCRNFSILLEPSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGS
WARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAA
ACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSM
YRARHYPPYAGGGGYVMSQATVRHLHMAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFK
TFGIQQPLNPRDPCLYKGLLLVHRLSPLEMWTMWALVTDERLKCAATHKP
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgttgcccaggttgggctgtgtgctgttctgcagtcttgtggtactactgctcagctgc
ctgctccttctgaaggagcgcataccagcaggcagctccaaggcccaccagcagttcttg
gcactgccaaggtcccaccatagccagtgctcacccaacctaacagttgttaacacctcc
ctgtccctgcccagccgtcatcgcctcttcttaacctatcgacactgccgaaacttctcc
atcttgctggagccttcggagtgtgccagggacaccttcctgctcctggtcatcaagtca
cagcctgctcatattgaacagcgttcagccattcgaagcacttggggccgggctgggagc
tgggctaggggtcggcagctgaagctggtgttcctcctgggggtggcaggacctgtgccc
ccggcccagctgttggtctatgagagctggcagtttgatgacatcttacagtgggacttt
gctgaggacttctttaacctgactctcaaggagctgcacgtgcagcgctggatcgcagct
gcctgcacacaggcccacttcatactaaagggagacgatgacgtctttatccatgttccc
aatgtgctcgagttcttggagggctgggatccggcccaggacttcctagtgggagatgtc
attcgcttggcccggcccaacaggaacaccaaagttaaatatttcatcccgttttccatg
tacagggcccgccactacccaccttatgcaggaggcggcggctacgtcatgtcccaggct
actgtgaggcatcttcacatggccatggaggaggcagagctctttcctattgacgatgtc
tttgtggggatgtgcctgaggaagctgggggtgactcccatacaccatgctggcttcaag
acatttggaatccaacagcccctcaatcccagggacccttgtctgtacaaagggctcctg
ctggtgcaccgtctcagccccctggagatgtggaccatgtgggcgctggtgacagatgag
aggcttaagtgtgcagctacccacaagccctag

DBGET integrated database retrieval system