KEGG   Mus musculus (mouse): 231801
Entry
231801            CDS       T01002                                 

Gene name
Agfg2, A630095P14Rik, Hr, Hrbl, RAB-R, RABR
Definition
(RefSeq) ArfGAP with FG repeats 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 231801
NCBI-ProteinID: NP_835456
MGI: 2443267
Ensembl: ENSMUSG00000029722
Vega: OTTMUSG00000021990
UniProt: Q80WC7
Position
5; 5 G2
AA seq 479 aa
MVMAAKKGPGPGGGVGGSKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVLFLQSRGNEVCRKIWLGLFDARTS
LIPDSRDPQKVKEFLQEKYEKKRWYVPPEQVKGPSYSKGSVSATPVQGSVPEGKPIRTLL
GDPVPSLSDPASTSSQPGSQSQARSSSQARSSQPPSHSSTKKASTDLLADIGGDPFAAPQ
VVPAFASFPGFGVGQTPAHGGFANFDAFSSSPSSSTFGSLPPSVQAPFQAQPTPAGSGQM
SAFGVAPLAAASQPNNLADVGGLLGPRMAAGGLPGSVFGMPSQVPALQSAVPGVSGSGGL
PFGAYTNPFATPAQAQLPSTNPFQPNGLASGPGFGMSSVRPGLLQPVPPSGAFASPFSAP
VFPTQAGLADQQNGSSFGDLGTSKLGQRPLSQPAGISTNPFMTGSSAFASKPPTTNPFL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggtgatggcggctaagaagggcccgggcccgggtggcggggtcggagggagcaaagcg
gaggctgaagccgcttcggaggtgtggtgccgccgagtgcgggagctgggcggctgcagc
caggccgggaaccgccactgtttcgagtgcgcccagcgcggggtcacgtatgtggacatc
accgtgggcagcttcgtctgcaccacctgctccggcctcctgagaggcctgaacccccct
catcgagtcaagtcaatctccatgacaactttcactgagcctgaagtcctgttcctccaa
tctcgtggaaatgaggtctgtcggaaaatctggctcggtctttttgatgctcggacatcg
ttgataccagattccagggatcctcagaaggtgaaggagtttctccaagaaaaatatgag
aaaaaaagatggtacgtccccccagagcaagtcaaggggccctcttacagcaaaggcagt
gtctctgctacccctgtccagggctctgtcccagaagggaaacccattcggacacttctg
ggagaccctgtgccatctctctctgatcctgcttccacttcaagccagcctgggagccag
tcgcaggcacgcagcagctcgcaggccaggagctcccagcctccttcccattcatccacc
aagaaagccagcactgacctgctggcggatatcgggggagacccctttgctgctccccag
gtggtgccagcctttgcctcattcccaggctttggagtaggccagactcctgcccatgga
ggctttgccaacttcgatgccttcagcagcagccctagctcttccaccttcggaagcctc
cctccatccgtccaagcgccattccaggcccagccgacccctgcaggaagtggccagatg
tctgcgtttggtgtggcaccccttgcagctgccagtcaacccaacaaccttgcagatgtg
ggcggcctcctgggtcccaggatggctgctggaggtctccctggcagtgtttttgggatg
ccgagccaggttcctgccctgcagtcggccgtgccaggtgttagcggcagtggagggctc
ccctttggagcctacaccaaccccttcgccacccctgcccaagcccagctgccttctacc
aacccattccaacccaatggtctagcctcagggcctggctttgggatgagcagtgttcgg
cctggccttctccagccagtgccaccctccggggcctttgccagtcccttctctgcaccc
gtgttccccacacaggctggactggccgaccagcagaatggatcttcctttggcgacttg
gggacctctaagctggggcagaggccactgagccagccggctgggatctctaccaatcct
ttcatgactggatcctcagcgtttgcctccaaacctccaaccacaaacccattcttgtag

DBGET integrated database retrieval system