KEGG   Mus musculus (mouse): 231830
Entry
231830            CDS       T01002                                 

Symbol
Micall2, A930021H16Rik, JRAB, Jr, MICA, MICAL-L2, mFLJ00139
Name
(RefSeq) MICAL-like 2
  KO
K21068  MICAL-like protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    231830 (Micall2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    231830 (Micall2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    231830 (Micall2)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    231830 (Micall2)
SSDB
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM
Other DBs
NCBI-GeneID: 231830
NCBI-ProteinID: NP_777275
MGI: 2444818
Ensembl: ENSMUSG00000036718
Vega: OTTMUSG00000036853
UniProt: Q3TN34
Position
5; 5 G2
AA seq 1009 aa
MAAIKALQEWCRQQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFSALRKENIYE
NNKLAFQVAEEQLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGIKR
PSSDSTEELSGKKGLSQPAKLPSPAQTQRSPLSPARTNPVVQRNEGGSQRPSPKAAPGTA
GSSVSSICGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSSTLHSGAYRATGEPGVFVCTH
HSSEVTSVSPKSSNLASRKPGGVTADTRPFGVSWTVQEANGEGTPLRVRTAAWEHAGGNT
TAKGFVQTELKPPSTSQVHVGSSAGPKLPTITVTTTSVTSKALTHVTNSSPIGWSSPAQS
SPANFNSRPVVSPSARNTHLPGSQGQTASKGVKTQLNLNSESSNTAVTPAWTSSASKTQQ
AREKFFQTPPSAPAPASAPAPAPTSKVPTVVTVPTSKVPNVVTAPTSKVPTVVTVPTSKV
PTVVSAPTSKVPTVVSAPTSKVPTVVNSTNSRVTTVVNAPTSKVPTVVSATNGRVPTVVT
AHTGRVPAVMNTSASKVSPVVDAPAQESSREQALSVLRKALPALTGSGTQAPNRSFPATS
SVLVTLPKNEVPQKVPSDKLSALTTQTPNFTIKLEPSAPVNVGNTAVFLQAGKKSPSISP
RVGKTSVGSRPQAEVAGVKGPGPISQEGQEEGPEGWRARLKPVDKKTPAGRSLEQKEPVL
AEPRIGDTSRKASSSSDSSVHITLTSIQHKRKPCPAGSGPSPAALSPSPSHRKKLAVPPS
LDVSADWLQPEPKKQEDGTRSCKEEKSPTRWSRERSAVLDSGLAPPGEAVTSPVRLHPDY
IPQEELQRQLQDIESQLDALELRGVELEKRLRAAEGDASEDSLMVDWFRLIHEKQLLLRL
ESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQDRQREQELLSQYVNTVNDRSDI
VDFLDEDRLREQEEDQMLENMIQNLGLQRKKSKSFLSKIWSSKSKSGQA
NT seq 3030 nt   +upstreamnt  +downstreamnt
atggccgccataaaggccctgcaagaatggtgccggcagcagtgcgagggctaccgggac
gtgagcatcaccaacatgaccacctcgttccgcgatggcctggccttctgcgctatcttg
caccgacaccggcctgaccttataaacttcagtgccctccggaaggaaaacatttacgag
aacaacaagttggccttccaagtggctgaggaacagctgggcatcccagccctgctagac
gctgaggacatggtggccttgaaggttccagaccggctgagcattctcacctatgtgtca
caatactacaactacttccatggccggtccccaattgggggcatggctggcataaagaga
ccctcatccgattcgaccgaagaactttctggaaagaagggcctgtcccagcctgccaag
ttgccctcgccggctcaaacccagaggtcaccactgtccccagctcggacaaaccctgtg
gttcagaggaatgaaggtggctcacaaagaccatccccaaaggctgctccggggaccgcg
ggaagctctgtcagcagtatctgtggggtctgtggcaaacatgttcaccttgtgcagcgg
cacctggctgacgggcgcctctaccaccgaagctgcttcaggtgtaaacagtgctccagc
acgctgcactcgggggcctaccgtgccacgggagagcccggagtcttcgtctgtacccac
cacagctcagaagtcacctctgtgagccccaagtcatcaaacctggcctccaggaaacca
gggggtgtcactgcagacaccaggccattcggcgtctcatggacggttcaggaggcaaat
ggagaggggacaccactgagggtcaggacagcagcatgggaacacgctggaggaaacaca
accgccaaaggttttgtccagacggaacttaagccaccatctacctcccaagtccacgtg
gggagctctgcggggcccaagctacccacgatcacagtgactactacttctgtgactagc
aaagctctcacccatgtgacgaatagctccccaataggatggtcatcgcctgcccagagc
agcccagcgaacttcaactcccgcccagttgtatccccaagtgctcggaacactcaccta
cctgggtcccaagggcagacagcctcaaaaggtgttaagactcagctcaacttgaactca
gagtcttcaaacacagcggtcaccccagcctggacttcctcagcctctaagacccagcag
gcccgagagaaatttttccagacccctccctcggccccagccccagcctcagccccagcc
ccagcccccaccagcaaggtccccactgtagtgactgtccccaccagcaaggtccccaat
gtggtgactgcccccaccagcaaggtccccactgtagtgactgtccccaccagcaaggtc
cccactgtggtgtctgcccccaccagcaaggtccctactgtggtgtctgcccccaccagc
aaggtccccactgtggtgaattccactaatagcagggtcaccacggtagtaaatgccccc
accagcaaggtccccactgtagtgagtgccacaaatggcagggtgcccactgtggtgact
gcccacactggtagggtccctgctgtgatgaatacctctgccagcaaagtctctcctgtt
gtggatgcccctgcccaggagagcagccgggagcaagcattaagtgtccttaggaaggcc
cttccggcgctgacaggatctggtacccaggctccaaacaggtccttcccagccacttcc
tctgtcctggtaacccttcccaagaatgaagtgccacaaaaagttccctcagacaagctc
tcagctttaaccacccagactcctaatttcactataaagctagagccttcagccccagtg
aatgtgggcaataccgctgtatttctccaggctggcaaaaagagcccgagtatttctcca
agggttggtaagaccagcgttggctccaggccacaagcagaggtggcaggagtaaagggt
ccaggtcccatctctcaggaaggccaagaggagggaccagaaggatggagggcccggctg
aagcctgtggataagaaaacccctgctgggaggtctctggagcaaaaagagccagtcctg
gcagagccaaggataggtgacacttccaggaaagcctctagtagctctgactccagcgtc
catatcaccttgacttctattcagcacaagaggaaaccatgccctgctggttccgggccc
agtcctgcagccctctctccttctccatcacaccgcaagaaactagctgtccctcccagc
cttgatgtttcagctgattggctccagccagagcccaagaagcaggaagatgggaccagg
agctgtaaggaggagaagtcacccaccaggtggtcaagagagaggtctgcagtcctggac
agtggccttgctccacctggtgaagctgtcacttccccagtcaggctccaccccgactat
atcccccaggaggagctgcagaggcagctgcaggacattgagagccaactggacgccctg
gagctcaggggtgttgagttggagaagcggctgcgggcagctgagggagatgcttctgag
gatagcctcatggtggactggttccggcttattcatgagaagcagctactgttgaggctg
gaatcggaactcatgtacaagtccaaggaccagcgcctggaggagcagcagctggacctc
cagggtgagctgcgcaggctgatggacaagccagagggtctgaagtccccccaggaccgc
cagcgggagcaggagctgctgagccaatacgtgaacaccgtgaatgaccgaagtgacatc
gttgacttcctggatgaggatcggctccgggaacaggaagaggaccaaatgctggagaat
atgatccagaacctgggcctccagagaaagaagtccaagtccttcttgtccaagatctgg
tcctcgaagagcaaaagcgggcaggcctga

DBGET integrated database retrieval system