KEGG   Mus musculus (mouse): 231871
Entry
231871            CDS       T01002                                 

Gene name
Daglb, E330036I19Rik
Definition
(RefSeq) diacylglycerol lipase, beta
  KO
K13806  sn1-specific diacylglycerol lipase [EC:3.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    231871 (Daglb)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    231871 (Daglb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     231871 (Daglb)
SSDB
Motif
Pfam: Lipase_3 Baculo_p74 Hydrolase_4
Other DBs
NCBI-GeneID: 231871
NCBI-ProteinID: NP_659164
MGI: 2442032
Ensembl: ENSMUSG00000039206
Vega: OTTMUSG00000021320
UniProt: Q91WC9
Position
5; 5 G2
AA seq 669 aa
MPGMVLFGRRWSLASDDLVFPGSFELFLRVLWWIVSLTLYLTHRRRLDCPGGVLLSTYLI
VLLVLLAVIICTVLAIVCVSMRGTICNPGPRKSMSKLLYIRLALFLPEMVWASLGAAWVA
KGIQCDRTVVIGIIATVIVSWIVIAATMVTIIFVFDPLGGKMAPYPPCIPEHLDSNSSNR
LLTGLKTAAKSVWETRVQFCCCCVGQDDNTRVAFSSTADLFSTYFSDTDLVPSDIAAGFT
LLHQQQDNISHSREPPEVVTHTPGQPQETELDAEVENCHHYMPFAAAAYGWPLYIYRNPF
TGLCRIGGDCCRARDIEYDAVEGDQHNCHFASILKTTGLQYRDFIHISFHDKVYELPFIV
VLDHRKESVVVAVRGTMSLQDVLTDLSAESETLELGIELQDCVAHKGIAQAARYIHRRLV
NDGILSQAFSVAPEYQLVLVGHSLGAGAAALLAIMLRGAYPQVRAYAFSPPRGLLSKSLY
EYSKDFVVSLILGMDVIPRLSVTNMEDLKRRILRVIANCNKPKYKILLHGCWYGLFGGSP
DNFPTELDEGTQGALTQPLLGEQTLLTRYSPGYCSSDSPLDSPTKYPTLYPPGRIIHLEE
EGGSGRFGCCSAAQYRARWAHEAEFSKILIGPKMLIDHMPDVMIRALDRVLADRTACVSC
PGQGGSSVP
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgccggggatggtgctgttcggccggcgctggtctctagccagcgacgacttggtgttc
cccgggtcttttgagctgttcctgcgtgtgctgtggtggattgtcagtctgacgttgtat
ctcacgcacagaaggaggctggactgtcccggtggagtcttgctcagcacgtacctgata
gtcctccttgttctcctggcagttattatatgcaccgtgttggccatcgtgtgtgtcagc
atgagaggaaccatttgtaaccctggacctcggaagtctatgtctaagctgctctatatc
cgcctggcgctcttcctgccagagatggtctgggcttctctgggggccgcctgggtggca
aaaggtatccagtgtgacaggacagttgtcattggcatcatcgccaccgtcattgtcagc
tggattgtcattgctgccaccatggtcaccatcatctttgtctttgacccgctgggcggg
aagatggctccgtatcccccatgcatcccggagcacctggacagtaacagctcaaaccgg
ttactgactggcctgaagacggctgcgaagagcgtgtgggagacccgggtgcagttctgc
tgctgctgcgttgggcaggatgataacaccagggtggcgttttccagcactgccgacctg
ttctccacctacttctctgacacagacctggtgcctagtgatatcgcagcaggcttcacc
cttctccaccagcaacaagacaatatcagccacagccgggagcctccggaggtcgtgacc
cacacaccaggacagcctcaggaaactgagttagatgcagaagtggagaactgccatcat
tacatgccgtttgcagcagctgcctatgggtggccgctctacatctacaggaacccgttc
acggggctgtgcaggattggtggcgactgttgcagagccagagacatagagtacgatgca
gtggaaggtgaccagcacaactgccacttcgcctccatcctgaagaccacagggctgcag
tacagggatttcattcacataagctttcacgacaaggtgtatgagctgcccttcatagtg
gttctggaccacaggaaggagtctgttgtggtcgccgtgagagggaccatgtctctccag
gacgtcctgaccgacctgtctgccgagagtgagaccctggagctggggattgagctacag
gactgtgtggcccacaagggaattgctcaagcggccagatacattcaccgcagactggtc
aatgatgggattctgagccaagccttcagtgtcgctccggagtaccagctcgttctggtg
gggcacagcctaggagccggcgctgcggccctgttagccatcatgctccggggggcctac
ccacaagtccgtgcttatgccttctccccgcccagggggctgctcagcaaatccctttac
gagtactccaaggactttgtcgtgtcgcttatcctagggatggatgtgatccccaggtta
agtgtgaccaacatggaggacctcaagaggaggatcctgagagtgatcgctaactgcaat
aagccgaagtacaagatcttgctgcatggctgttggtacggactgttcggaggaagccct
gataactttccaactgaactggatgagggcacccagggggccctgactcagcctcttctt
ggagagcagacacttctaacccgatactccccgggctactgttccagcgactccccactg
gactcccccaccaagtaccccactctgtacccacctggcaggatcatccacctggaagag
gagggtggttcagggaggtttggctgctgttctgctgcccagtacagagcgaggtgggca
cacgaagcagaattcagtaagatcctgataggcccaaagatgctgattgaccacatgcct
gacgtcatgattcgggccctggacagagtgcttgccgacaggacagcctgcgtctcctgc
ccagggcaaggcggctcaagtgtaccgtag

DBGET integrated database retrieval system