KEGG   Mus musculus (house mouse): 231889
Entry
231889            CDS       T01002                                 
Symbol
Bud31, C77604, EDG-2, EDG2, G10
Name
(RefSeq) BUD31 homolog
  KO
K12873  bud site selection protein 31
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    231889 (Bud31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    231889 (Bud31)
Spliceosome [BR:mmu03041]
 Complex B
  Other components
   Prp19-related factors
    231889 (Bud31)
 Complex C
    231889 (Bud31)
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 231889
NCBI-ProteinID: NP_001297699
MGI: 2141291
Ensembl: ENSMUSG00000038722
UniProt: Q6PGH1
Position
5:145077186..145084888
AA seq 144 aa
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKSKLEVGRIIECTHCGCRGCSG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcccaaggtcaaaagaagccggaaagcacctccagatggctgggagttgattgaacca
acgttggatgaactagatcaaaagatgagagaagctgaaactgaaccccatgagggaaag
aggaaagtggaatctctgtggcccatcttcaggatccatcaccagaaaacccgctatatc
ttcgacctcttttacaagaggaaagccataagcagagaactctatgaatactgcattaaa
gaaggctatgcagacaaaaacctgattgcaaagtggaagaagcagggctatgagaaccta
tgctgcctacgctgcattcagactcgggacaccaactttggcaccaactgcatttgccgg
gttcccaaaagcaagctggaagtgggtcgcatcatcgagtgcacacactgtggctgccgg
ggttgctctggctga

DBGET integrated database retrieval system