KEGG   Mus musculus (mouse): 231903Help
Entry
231903            CDS       T01002                                 

Gene name
Urad, EG231903, Prhoxnb
Definition
(RefSeq) ureidoimidazoline (2-oxo-4-hydroxy-4-carboxy-5) decarboxylase
  KO
K13485  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:4.1.1.97]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    231903 (Urad)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     231903 (Urad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OHCU_decarbox
Motif
Other DBs
NCBI-GeneID: 231903
NCBI-ProteinID: NP_001034767
MGI: 3647519
Ensembl: ENSMUSG00000075543
Vega: OTTMUSG00000044795
UniProt: Q283N4 B9EK13
Position
5; 5 G3
AA seq 178 aa AA seqDB search
MDMVKVNSMDFGEFVDVFGNIVEKCPLIAAAVWSQRPFSGLEDLENHFFAFIDALPRSGQ
EGILRCHPDLAGRDLQQGTLTAESQREQSQAGLTSLDTDDRLRLQQLNAQYRERFGFPFV
LAARLSDRATVPRELARRLQCQPESELRTALGEVKKISHLRLTDLLGAHSHSARVELP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggacatggtgaaggtcaattccatggacttcggagaatttgtggatgtgtttgggaac
attgttgagaaatgccctctgattgccgctgctgtctggtcccagcgtccattctctggc
ttggaagacttagaaaatcacttttttgcctttattgatgctctcccgagatcaggccag
gaaggcatcctgcgttgtcacccggacctagctggccgtgatctgcaacagggcacactc
actgctgagtcacagcgtgagcagagccaagcaggtctcactagcctagacaccgacgac
aggctgcggctgcagcaactcaatgctcagtaccgtgagcgcttcggctttccgttcgtt
ctggcagcgcgcctgagcgaccgtgccactgtgccccgagagctagcccgcaggcttcag
tgccagccggaatccgagctgcgcaccgccctgggtgaagtgaagaagatcagccacctg
cgcctgacagatttgctcggtgcccactcccactccgccagggtggaactaccgtga

DBGET integrated database retrieval system