KEGG   Mus musculus (mouse): 232087
Entry
232087            CDS       T01002                                 

Gene name
Mat2a, D630045P18Rik, MAT_2
Definition
(RefSeq) methionine adenosyltransferase II, alpha
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
mmu01230  Biosynthesis of amino acids
Module
mmu_M00034  Methionine salvage pathway
mmu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    232087 (Mat2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     232087 (Mat2a)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N AdoMet_Synthase
Other DBs
NCBI-GeneID: 232087
NCBI-ProteinID: NP_663544
MGI: 2443731
Ensembl: ENSMUSG00000053907
Vega: OTTMUSG00000057919
UniProt: Q3THS6 Q99J57
Position
6; 6 C1
AA seq 395 aa
MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVA
KTGMILLAGEITSRAAIDYQKVVREAIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQG
VHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDS
KTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDT
IYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPGVI
VRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaacgggcagctcaacggcttccacgaggcgttcattgaggaggggacgttcctcttc
acttccgagtctgtaggggaaggtcacccagataagatttgtgaccaaatcagtgatgct
gtccttgatgcacaccttcaacaagaccctgatgctaaagtggcttgtgaaactgttgct
aaaactggaatgattcttcttgctggggaaattacatccagagctgccattgattaccag
aaagtggttcgtgaagccataaagcacattggatatgatgactcttccaaagggtttgac
tacaagacttgtaatgtgttggttgccttggaacaacagtcaccagatattgcccaaggt
gttcatcttgaccggaatgaggaagatattggtgcaggagaccagggtttgatgtttggt
tatgccactgatgaaactgaagagtgtatgcctttaaccattgtcttagcacacaagcta
aatgccaaattggctgaactacgccgcaatggtacattgccttggttacgcccagattct
aaaactcaagtgactgtgcaatatatgcaagatcggggtgctgtgcttcccatcagagtc
cacacgattgttatatctgttcagcacgatgaagaagtttgtcttgatgagatgagggat
gctctgaaggagaaagtgatcaaggctgttgtacctgcaaaataccttgatgaggataca
atttaccacctacagccaagtggcagatttgttattggtgggcctcagggtgatgctggc
ctgactggccgaaaaatcattgtggatacttatggcggttggggagctcatggaggaggg
gccttttcaggaaaggattataccaaagtggaccgttcagctgcttatgctgctcgttgg
gtggcaaaatcccttgttaaaggaggtctgtgcaggagggttcttgttcaggtctcttat
gctattggagtttctcatccattgtcgatctccattttccattatggcacttctcagaag
agtgagagagagctattagaaattgtaaagaagaattttgatcttcgccctggggtcatt
gtcagggatctggatctgaagaagccaatttatcagaggactgcagcctatggccacttt
ggtagggacagcttcccatgggaagtgcccaaaaagcttaaatattga

DBGET integrated database retrieval system