KEGG   Mus musculus (house mouse): 232157
Entry
232157            CDS       T01002                                 
Symbol
Mob1a, 4022402H07Rik, MOB1, MOB4B, Mobk1b, Mobkl1b
Name
(RefSeq) MOB kinase activator 1A
  KO
K06685  MOB kinase activator 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    232157 (Mob1a)
   04392 Hippo signaling pathway - multiple species
    232157 (Mob1a)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 232157
NCBI-ProteinID: NP_663546
MGI: 2442631
Ensembl: ENSMUSG00000043131
UniProt: Q921Y0
Position
6:83303016..83319794
AA seq 216 aa
MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN
TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagcttcctcttcagcagccgctcttcgaaaacattcaaaccaaagaagaatatccct
gaagggtcccatcagtatgagctcttgaagcatgcagaggcgactctcggaagtggcaat
ctgaggcaagctgttatgttgcctgagggagaggacctcaatgaatggattgctgttaat
actgtggatttcttcaatcagatcaacatgttgtatggaaccattacagaattctgcact
gaggcaagctgcccagtcatgtcggcaggtcccaggtatgaataccactgggcagatggc
actaatattaaaaagccaattaagtgttctgcaccaaaatatattgactatttgatgact
tgggttcaggatcagcttgatgacgaaactctttttccttctaagattggtgtccctttt
cccaaaaactttatgtctgtggcaaagactattctgaagcgtctcttcagggtttatgcc
catatctaccaccagcactttgactccgtgatgcagctgcaggaggaggctcacctcaac
acctcctttaagcactttattttctttgttcaggagtttaatctgattgataggcgtgag
ttggcaccacttcaggaattaattgagaagcttggatctaaagacagataa

DBGET integrated database retrieval system