KEGG   Mus musculus (mouse): 232174
Entry
232174            CDS       T01002                                 

Gene name
Cyp26b1, CP2, CP26, P450R, P450RAI-2
Definition
(RefSeq) cytochrome P450, family 26, subfamily b, polypeptide 1
  KO
K12664  cytochrome P450 family 26 subfamily B [EC:1.14.14.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    232174 (Cyp26b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    232174 (Cyp26b1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     232174 (Cyp26b1)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP26 family
   232174 (Cyp26b1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 232174
NCBI-ProteinID: NP_001171184
MGI: 2176159
Ensembl: ENSMUSG00000063415
Vega: OTTMUSG00000057844
UniProt: Q811W2
Position
6; 6 C3
AA seq 512 aa
MLFEGLELVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG
ETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILLGEHQLVSTEWPRS
ARVLLGPNTVANSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSQPEAIN
VYQEAQRLTFRMAVRVLLGFSIPEEDLGHLFEVYQQFVENVFSLPVDLPFSGYRRGIQAR
QILQKGLEKAIREKLQCTQGKDYSDALDILIESSKEHGKEMTMQELKDGTLELIFAAYAT
TASASTSLIMQLLKHPAVLEKLREELRAQGLLHGGGCPCEGTLRLDTLSSLRYLDCVIKE
VMRLFTPVSGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVL
HPVDGLSVKFFGLDSNQNEILPETEAMLSATV
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgctgtttgaaggcttggagttggtgtcggcgctggccaccctcgccgcgtgcctggtg
tccgtgacgctgctgctggcggtgtcgcagcagctgtggcagctgcgctgggctgccacc
cgcgacaagagctgcaagctgcccatccccaagggctccatgggattcccgctcatcgga
gagactggtcactggttgctacagggttccggcttccagtcgtcgcgccgggagaagtat
ggcaacgttttcaagacacacttactggggcggccgctgattcgtgtgaccggtgcggag
aatgtgcgcaagatcctactgggcgaacaccagctagtgagcaccgagtggccgcggagc
gcacgcgtactgctgggtcccaacacggtggccaattccattggcgacatccaccgcaac
aagcgcaaggtcttctccaagatcttcagccatgaggcacttgagagctacctgcccaag
atccaactggtgatccaggatacacttcgagcctggagcagccagcctgaggccatcaat
gtatatcaggaggcccagcgacttaccttccgaatggccgtgcgtgtgctgctaggcttc
agcatccctgaggaggacctgggccacctctttgaggtataccagcagtttgtggagaat
gtcttctctctgccagtggacctgcccttcagtggctaccggaggggcatccaagctcgg
cagatccttcagaagggcctagagaaggctatccgtgagaagctgcagtgtacccagggc
aaagactactcggacgccctggacattctcattgagagcagcaaggaacatggcaaggag
atgaccatgcaggagctgaaggatggaaccctggagttgatcttcgcagcctacgccacg
acggccagtgcaagcacatccttgatcatgcaactgctaaaacaccctgctgtgctggag
aagctgagggaggaactgcgggcccagggcctgctgcatggcggtggctgcccctgtgag
ggtaccctgcgcctggacacgctcagcagcctgcgctacctggactgtgtcatcaaggag
gtcatgagactcttcacgcccgtctcaggcggctaccgcactgtgctgcagaccttcgaa
ctggatggtttccagatccccaagggctggagtgtcatgtatagcatccgagacactcac
gacacagcgcccgtgttcaaggacgtgaatgtgtttgacccggaccgcttcagtcaggca
cgcagtgaggataaggatggccgcttccattacctcccgtttggcggtggcgtgcggacc
tgcctgggcaagcacttggccaagctgttcctgaaggtgctggcagtggagctggccagc
actagccgcttcgagctggccacccggaccttccctcgcatcactctggtccccgtcttg
caccccgtggatggcctcagtgtcaagttctttggtctggactccaaccagaatgagatt
ctgccggagacagaggccatgttgagtgctacggtgtag

DBGET integrated database retrieval system