KEGG   Mus musculus (mouse): 232187
Entry
232187            CDS       T01002                                 

Symbol
Smyd5, AW536703, NN8-4AG, Rai15, Rrg1
Name
(RefSeq) SET and MYND domain containing 5
  KO
K24635  SET and MYND domain-containing protein 5 [EC:2.1.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    232187 (Smyd5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     232187 (Smyd5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   232187 (Smyd5)
SSDB
Motif
Pfam: SET zf-MYND
Other DBs
NCBI-GeneID: 232187
NCBI-ProteinID: NP_659167
MGI: 108048
Ensembl: ENSMUSG00000033706
Vega: OTTMUSG00000017438
UniProt: Q3TYX3
Position
6 C3; 6 37.44 cM
AA seq 416 aa
MAASMCDVFSFCVGVADRARGSVEVRYVDSIKGKGLFATQLIRKGETIFIERPLVAAQFL
WNALYQYRACDHCLRALEKAEENAQRLTGKPSQILPHPELCSVRKDLHQNCPHCQVMYCS
AECRLAAAEQYHQILCPGPSHDPRHPLNKLQEAWRSVHYPPETASIMLMARMVATVKQAK
DKDHWVRLFNHFCSRTANQEQAIVHKLLKGKFKDQLELLLGLFKEALYEEALSLWFTPEG
FRSLFALVGTNGQGIGTSSLSQWVHACDALELTPQDREQLDTFIDQLYKDIEAATGEFLN
CEGSGLFVLQSCCNHSCVPNAETSFPENNFVLHVTALEDIKPGEEICISYLDCCQRERSR
HSRHKILRENYLFNCSCPKCLAEADDPNVTSEEEEEEDEEEGEPEDAELGDEMTDV
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcggcctccatgtgcgacgtgttctccttctgcgtgggcgtggcggaccgtgcccgg
ggttccgtggaagtccgttatgtggacagcatcaagggaaagggactgtttgccacacag
ctgattcggaagggagagaccatcttcattgaaagacctctggtagctgcgcagttcctc
tggaatgcactttatcagtacagggcctgtgaccactgccttcgggcactggagaaggca
gaggagaatgcccagaggctgactgggaaaccaagccagattctaccacacccagagcta
tgcagtgtgcgtaaggacctccaccagaactgcccccattgccaggtgatgtactgcagt
gcagaatgtcggctagcagctgcagagcagtaccaccaaatcctgtgcccaggcccatcc
catgacccccggcaccccctcaataagctgcaggaggcatggaggagtgttcactatcct
cctgagactgcgagtataatgctgatggcccggatggtagccacggtgaaacaggccaag
gacaaggaccactgggtcagactcttcaaccacttctgcagcaggacagccaaccaggag
caggcaattgtccacaaactcctaaagggcaagttcaaggaccagctggaacttctgctt
gggctcttcaaagaggccctttatgaagaggctctcagtctgtggttcacaccagaagga
ttccggtctctctttgcccttgttgggaccaatggtcaaggaatcggaaccagttccctc
agccaatgggtgcacgcctgtgatgccctggagctgacgcctcaggaccgggaacaacta
gacaccttcattgaccagctgtacaaggacatcgaggcagcaaccggagagttccttaac
tgtgaaggatctggcctcttcgtgcttcaaagctgctgcaaccacagctgtgtccccaac
gcggagacctcctttccagaaaacaacttcgttttacatgttactgccctggaggatatt
aagccaggcgaggaaatatgtatcagctacttagactgctgtcagcgggagcgcagccga
cacagccgacacaagatcctcagggagaactacttgttcaactgttcctgtcccaaatgc
ctggcagaggctgatgaccccaatgtgacctcagaagaggaggaagaggaagatgaggag
gaaggagagccagaagatgcagagctaggggatgagatgaccgacgtgtga

DBGET integrated database retrieval system