KEGG   Mus musculus (mouse): 232210
Entry
232210            CDS       T01002                                 

Symbol
Hmces, 8430410A17Rik, C85376, S, Srap1
Name
(RefSeq) 5-hydroxymethylcytosine (hmC) binding, ES cell specific
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SRAP
Other DBs
NCBI-GeneID: 232210
NCBI-ProteinID: NP_776098
MGI: 1914053
Ensembl: ENSMUSG00000030060
Vega: OTTMUSG00000023514
UniProt: Q8R1M0
Position
6; 6 D1
AA seq 353 aa
MCGRTSCHLPREVLTRACAYQDRQGRRRLPQWRDPDKYCPSYNKSPQSSSPVLLSRLHFE
KDADSSDRIIIPMRWGLVPSWFKESDPSKLQFNTTNCRSDTIMEKQSFKVPLGKGRRCVV
LADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGGNDASDSSDNKEKVWDNWRLLTMAGIF
DCWEAPGGECLYSYSIITVDSCRGLSDIHSRMPAILDGEEAVSKWLDFGEVATQEALKLI
HPIDNITFHPVSPVVNNSRNNTPECLAPADLLVKKEPKANGSSQRMMQWLATKSPKKEVP
DSPKKDASGLPQWSSQFLQKSPLPAKRGATSSFLDRWLKQEKEDEPMAKKPNS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtgcgggcgaacgtcctgtcacttgcccagagaggttctcaccagggcctgcgcctat
caggatcggcagggccggcggcggctcccgcagtggagggaccccgacaagtactgcccc
tcctacaacaagagcccgcagtccagcagccccgtgctgctctccagactgcactttgag
aaggatgcagactcatcagatcggataattattcccatgcgatggggcttagtcccatct
tggttcaaagaaagtgatccttctaagctgcagttcaacactaccaactgtcgtagtgat
accataatggagaagcagtcattcaaggttcctctggggaaaggacggcggtgtgttgtt
ttagcagatggattctacgagtggcagcggtgtcagggaacaaaccagaggcaaccatac
ttcatctattttcctcaaatcaagacagagaagtcaggtgggaacgatgcttcagacagc
tctgacaacaaggaaaaggtctgggacaactggaggctgctgacaatggcagggatcttt
gactgctgggaagcgccagggggagagtgcctgtattcctacagcatcatcactgtggat
tcctgcagaggtttgagtgacatccacagcaggatgcctgccatactagatggagaagaa
gcagtctccaaatggctcgactttggtgaggtcgccactcaggaagctctgaagctaatc
caccccatagacaatatcaccttccatccagtttctccagtggtgaacaattcccgaaac
aacactccggagtgtctggcgcctgctgacttgctggttaagaaggagcccaaggcaaat
ggcagcagtcaaaggatgatgcagtggctggctacaaagtcacccaaaaaggaagtccct
gactcacccaaaaaggatgcatcaggtctaccccagtggtccagccagtttctccagaag
agcccattgcctgctaaaagaggtgctaccagcagcttcctggatcgatggctgaagcag
gagaaggaggatgagcccatggccaagaagcctaacagctag

DBGET integrated database retrieval system