KEGG   Mus musculus (mouse): 232237Help
Entry
232237            CDS       T01002                                 

Gene name
Fgd5, C330025N11Rik, ZFYVE23, mFLJ00274
Definition
(RefSeq) FYVE, RhoGEF and PH domain containing 5
  KO
K05724  FYVE, RhoGEF and PH domain containing 5/6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    232237 (Fgd5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH FYVE PH_13 PH_9 IQ_SEC7_PH FYVE_2
Motif
Other DBs
NCBI-GeneID: 232237
NCBI-ProteinID: NP_766319
MGI: 2443369
Ensembl: ENSMUSG00000034037
Vega: OTTMUSG00000023856
UniProt: Q80UZ0 E9QKY4
Position
6; 6 D1
AA seq 1514 aa AA seqDB search
MHRADSPKPPLAPKPKVATNPYAPAAKFPPSQRPDSFPSPNSMSRGPKPPIAPKPRLTGP
SEYLNNSLGKCSNGRLLCEDRGLYDGHHSTLNCLELEPDEQYIMVPRAPQKEDTPVDGAT
EEPGFEGEVQEHGTEQTGTEGDLEAPDEEAPSRDSEEGMVHALEDEDCDHDPETDGTPTS
PDEGAPSRDSEEGEEDCDQGPGMEEHPMSEEEGEEEEVKEHVYNSDNRAPWDGEEPFPNE
VILTHVRSQSPEVPCWEPGPPETPGEAEEDCEDICNNTEPGKPNQDTGQDTEDAGMGSPE
SEVSPDVQEQEAATDNPEVFEEDSADAAEGEDQIEQEEPPNCDEEAYNRDAAAATMQVGE
DLGEEGDHVQEDPAEESCQIIPFESDSVEEDFSPTLTENPYEIFPTESTSFCNNTYSLDE
SANGHEPVCEICVEEVPGVGPPLNQHDSLPDGSGEDSPVVPDVVVVPENEGPVDDALSSP
YVMGVGLLSLGEGAQSDTQAASGTLSGYSTWEEGDSEGGQVPVDRKNIATRARPHSGKVA
GHVPETVLEETGPETCSSGMGIRDTSDEVRKIGILPEGKPPECVRALPAKPRAFTLYPRS
FSVEGRESPLSMFREPEGAGLDSHRVRRKEDNLSLPGAIGSSGSFSQRSHLPSSGTSTPS
SVVDIPPPFDLACITKKPITKSSPSLLIDGDTLEKASKKKKSSFKRFLELTFRKKTESKV
HVDMNLSSSRSSSESSYHGPARVLELDRRSLSNSPQLKCRTGKLRASDSPAALIFYRDSK
RKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQI
PPRRPVRTGTFTKLFEEQSRALSTANENDGYVDMSSFNAFESKQQSSEQEAESAYTEPYK
VCPISAAPREDLTSDEEQGSSEEEDSASRDPSLSHKGEGQSRALVIAQELLSSEKAYVQM
LQHLSLDFHGAVLRALENVEQEGREPLAQEELRQGLRELPAICDLHQGILESLEQRLGDC
GEGQPQVADIFLAQEQEFEHHAAHILQFDRYLGLLAESCLLSPRLATTVREFEQSSQGGG
QSMKHRMLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQSALTLISKVTDRANESMEQGE
NLQKLVHIEYSVRGQGDLLQPGREFLKEGTLMRVRGKSRHPRHLFLMNDTLLYTHPQKDG
KYRLKSSLPVANMKVSRPVMDKVPYALKIETPESCLTLSASSCAERDEWHYCLSRALPED
YKTQALAAFHHSVEIRERLGISLGERLPTLVPVTHAMMCMNCGCDFSLTVRRHHCHACGK
IVCRNCSRNKYPLKCLKNRMAKVCDGCFRELKLRNGPVPGSMRERPVSMSFPLSSSRFSS
GSALSSVFQSISPSTFKKQKKVPSALSEVAASGEGSAISGYLSRCKSGKRRWKKLWLVIK
GKVLYTYLASEDKVAMESIPLLGFTIAPEKEEGSSEVGPVFHLYHKKTLFYSFKAEDSNS
AQRWMEAMEDASVL
NT seq 4545 nt NT seq  +upstreamnt  +downstreamnt
atgcacagagcagattcaccaaagccaccacttgctcccaagccaaaggttgctaccaac
ccttatgcaccggcagccaagtttcccccttcacagaggcctgacagcttccccagtccc
aactccatgtccaggggccccaagccccctatcgctcctaagcccagactgactggcccc
agtgagtacctgaacaacagcctcggcaaatgcagcaatgggaggctgctctgtgaggac
cggggcctgtacgacggacaccactccaccctgaattgcttggagttggagcctgatgag
cagtatatcatggttcccagggctccacagaaagaagatactcccgtggatggggctacc
gaggagccggggtttgagggggaagtccaggagcatggtacagagcagacaggaactgag
ggggacctggaagctccagatgaagaggcaccaagtagagacagtgaggaaggcatggtc
cacgctctggaagatgaagactgtgatcacgatccagagacggatgggaccccaacatcg
ccagatgaaggggcaccaagcagagacagtgaggaaggtgaggaggactgtgatcagggc
ccaggtatggaggagcatcccatgagtgaagaggagggagaagaggaggaggtgaaggag
cacgtgtacaacagtgataacagggcaccctgggatggagaggagcccttccccaatgag
gtcattctcacacatgtccgctctcagtcccctgaagttccctgttgggagccaggccct
cctgagactcctggagaggcagaagaggattgtgaagacatctgtaacaacacagaacct
gggaaacccaatcaggacactggtcaggacacagaggatgccggcatgggatcccctgag
agtgaggtgtccccagatgtccaggagcaagaggcagcaacggacaaccctgaggtcttt
gaggaggactctgcagatgctgcagaaggtgaggatcagatagagcaggaggaaccaccc
aattgtgacgaggaagcctataatagagatgccgcagcagccaccatgcaggtgggagag
gacctcggagaggagggagaccatgtgcaggaggaccctgctgaggaaagctgccagatc
attccctttgagagcgacagtgtggaggaggatttctcacctacactcacagagaatccc
tatgagattttcccaaccgagagcacttccttctgcaataacacctattcccttgacgag
tcagccaatgggcacgagccagtgtgcgagatctgtgtagaggaggttcctggtgttggc
cctccacttaaccagcatgattccctgccagatggatctggagaggactccccggtggtc
cctgatgtggtggtcgtgccagagaatgaggggcccgtggatgatgcactcagcagtcca
tacgtgatgggagttggcttgctgagccttggagagggagcgcagtcagacacccaggct
gcatcaggcactctgagtgggtacagtacatgggaggaaggggactctgagggagggcag
gtcccagtggataggaagaatattgccacaagggcccggcctcactctgggaaggtggct
ggtcatgttccagaaactgttctagaagaaacgggaccagaaacctgttcatcaggcatg
ggcatcagagataccagtgatgaagtgaggaagataggtatattgccagagggaaagcct
cccgagtgtgttcgggccttgccggccaagcccagagcatttactctctacccaaggtcc
ttctctgtagaaggccgggagagtcccctgtccatgttccgggagccagagggagccggg
ctggacagccaccgtgtaaggaggaaagaggacaacctctctctgccgggcgccatcggc
tcctccggtagcttctcacagcgcagccacctgccttccagtggcacctccacaccatcc
tctgtggttgacatcccacccccttttgacttggcctgcatcacgaagaaacccatcact
aaaagctcaccctcactcctgatagacggagacaccctggaaaaagcctctaagaagaag
aagtcctccttcaaacgcttcctggagctgacgttcaggaagaagacagagagcaaggtg
cacgtggacatgaacctgtcgtcttccaggtcttcctctgagtccagctaccatggtcca
gccagggtactggaacttgaccgcagaagcctcagcaactcgccccagctcaagtgtcgc
actggaaagctccgggcctctgactccccggccgccctcatcttctacagggacagcaag
aggaaaggcgtccccttcagcaggacggtgtccagagtggagtccttcgaagaccgctcc
cggccgccctttctgcctctgcccctcaccaagccacggtccatctcattccccaatgcc
gacacttcggactatgagaacattccagccatgaactcagactatgagaatatccagatc
ccccctcgcaggccggtgaggactggcactttcacaaagctgttcgaagaacagagccga
gccctgtccaccgcaaatgaaaatgacggctacgtggacatgagcagcttcaatgccttc
gagagcaagcagcagagttcagagcaggaagctgagagcgcctacactgagccctacaag
gtctgtcccatctcagcggctcccagagaggacctcacatcagacgaagaacaaggaagc
tccgaggaggaggacagtgcttcaagagaccccagcctctcacacaagggtgaaggacag
tctagagcccttgtcatcgctcaggagctgctgtcttcagagaaagcatatgtgcagatg
ttgcagcacttaagcctggatttccatggagccgtcctgagggccttggagaacgtagag
caagagggcagagagccactggcccaggaggagctgcggcagggcctgcgggagctccca
gctatctgtgaccttcaccagggcatcctggagagcctggagcagaggctgggggattgt
ggggagggccagccgcaggtggccgacatcttcctggcccaggaacaggagttcgagcat
catgccgcacacatcctgcaatttgacaggtacctggggctgctcgctgagagctgcctg
ctctcaccccggctagccaccacggtccgggagtttgagcagagttcacaagggggtggc
cagagcatgaagcatcgtatgctgcgtgtggtccagcgcctcttccagtaccaagtgctg
ctcactgattatttaaataacctgtgcccggactcagcagagtacgacaacactcagagt
gctctgactctcatctctaaagtgacagaccgtgccaacgaaagcatggaacagggggaa
aacctgcagaagctggtccacatcgagtacagtgtacgaggccaaggggacctcctccag
ccaggaagggagttcctgaaggaagggacactgatgagggtgagagggaaaagccgacac
ccccgccacctgttcctgatgaatgacacactcctgtacacacatccccagaaggatggg
aagtaccggctgaagagctcgctgccagtggccaacatgaaggtcagccgccctgtgatg
gacaaagtgccctatgctctgaagatcgaaactcctgagtcttgtctgacactgtctgca
agctcctgcgcggagcgggacgagtggcactactgtctgagcagagcccttccggaggat
tacaagactcaggccctggctgccttccaccacagtgtggagatccgggaaaggctgggg
atcagcctcggtgagaggctccccaccctggtgcctgtcactcatgccatgatgtgcatg
aactgcggctgtgacttctccctcaccgtgaggcgccaccactgccatgcctgcggcaag
attgtgtgccggaactgctctcgaaacaagtacccattgaagtgcctcaagaacaggatg
gccaaggtctgtgatggctgcttccgggagctgaagttgaggaatgggcctgtcccaggc
tccatgagagagcgtccagtcagcatgagcttcccactgtcctcgtcccgcttttcctcg
ggcagcgccttgtcctctgtcttccagagtattagcccctcaactttcaagaagcagaaa
aaagtcccttcggctctgtccgaggtggccgcgtcaggagagggctctgccatcagcggc
tacttgagccgctgtaagagtggcaagcggcgctggaagaaactctggctcgtcatcaag
ggcaaagtactctacacctacttggccagcgaggacaaagtggccatggagagcatacct
ctgctgggttttactattgccccagaaaaggaggagggcagcagcgaagtgggccctgtt
tttcatctttatcacaagaaaaccctgttttacagcttcaaagcagaggacagcaattct
gctcagagatggatggaggccatggaagatgccagtgtgttatag

DBGET integrated database retrieval system