KEGG   Mus musculus (mouse): 232333
Entry
232333            CDS       T01002                                 

Gene name
Slc6a1, A730043E01, GABATHG, GABATR, GAT-1, Gabt, Gabt1, Gat1, XT-1, Xtrp1
Definition
(RefSeq) solute carrier family 6 (neurotransmitter transporter, GABA), member 1
  KO
K05034  solute carrier family 6 (neurotransmitter transporter, GABA) member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    232333 (Slc6a1)
   04721 Synaptic vesicle cycle
    232333 (Slc6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    232333 (Slc6a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   232333 (Slc6a1)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 232333
NCBI-ProteinID: NP_848818
MGI: 95627
Ensembl: ENSMUSG00000030310
Vega: OTTMUSG00000056591
UniProt: P31648 Q6PCX2
Position
6; 6 E3
AA seq 599 aa
MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGY
AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP
MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLV
NTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVV
YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG
PGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR
ELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF
YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLM
ALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI
NT seq 1800 nt   +upstreamnt  +downstreamnt
atggcgactgacaacagcaaggtggctgatgggcagatctctactgaggtcagcgaggcc
cctgtggccagcgacaagcccaaaaccctggtagtcaaggtgcagaagaaggccggggac
ctccctgaccgggacacatggaagggacgcttcgacttcctcatgtcctgcgtgggctat
gccatcggcctgggcaatgtgtggaggttcccttacctctgtgggaaaaacggtggcggg
gccttcctaatcccatatttcctgacgctcatctttgcgggtgttcctctcttccttttg
gagtgctccctaggccagtacacctccattgggggcctgggcgtatggaagctggcgccc
atgttcaagggtgtgggcctcgcggcagctgtgctgtccttctggctgaacatctactac
atcgtcatcatctcctgggccatctactacctgtacaactccttcaccacgaccctgcca
tggaaacagtgtgacaacccgtggaacactgaccgctgcttctccaactacagcctggtc
aataccaccaacatgaccagcgccgtggtggagttctgggagcgcaacatgcaccagatg
acagatggactggacaagccaggacagatccgctggcctctggccatcacactggccatt
gcctgggtgctcgtgtatttctgcatctggaagggtgttggttggactggaaaggtggtc
tacttctcagccacgtacccctacatcatgcttatcatcctgttcttccgtggagtgacg
cttcccggggccaaggaggggatcctcttctacatcacacccaacttccgaaagctgtct
gattctgaggtgtggcttgacgccgccacccagatcttcttctcctacgggctgggcctg
gggtccctgattgctctgggaagctacaactctttccacaacaatgtgtacagggactcc
atcatcgtttgctgcatcaactcctgcaccagcatgtttgccggattcgtcatcttctcc
atcgtgggcttcatggctcatgtcaccaagaggtccatagctgatgtggcagcctcaggc
ccggggctggcattcttggcgtaccctgaggctgtgacacagctacccatctctcccctc
tgggctatcctcttcttctccatgctgctgatgctgggcattgacagccagttctgtacc
gtggagggcttcatcactgccctggtggacgagtaccccagacttctccgcaatcgccgt
gaactcttcattgctgccgtgtgcatcgtgtcctacctgattggcctgtctaacatcacc
cagggtggcatttatgtcttcaaactgtttgattattactctgccagcggcatgagcttg
ctgttcctggttttcttcgagtgtgtctccatttcctggttttatggtgtcaaccggttc
tatgacaacatccaggagatggttggctccaggccctgcatctggtggaagctgtgctgg
tcctttttcacacccatcattgtggcgggcgtgtttctcttcagtgctgtgcagatgaca
ccactcaccatgggaagctatgttttccccaagtggggccagggcgtgggctggctcatg
gctctgtcctccatggtgctcatccccgggtacatggcttacatgttcctcaccctgaag
ggctccctgaagcagcgtctccaggtcatgattcagcccagtgaagatattgtgcgccct
gagaatggccctgagcagccgcaggctggcagctcagccagcaaggaggcctacatctag

DBGET integrated database retrieval system