KEGG   Mus musculus (mouse): 232413
Entry
232413            CDS       T01002                                 

Gene name
Clec12a, CLL-1, D230024O04, KLRL1, Micl
Definition
(RefSeq) C-type lectin domain family 12, member a
  KO
K17516  C-type lectin domain family 12 member A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    232413 (Clec12a)
   04090 CD molecules [BR:mmu04090]
    232413 (Clec12a)
   04091 Lectins [BR:mmu04091]
    232413 (Clec12a)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   232413 (Clec12a)
CD molecules [BR:mmu04090]
 Proteins
  232413 (Clec12a)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   232413 (Clec12a)
SSDB
Motif
Pfam: Lectin_C DUF4635 TssO SMP_2 LapA_dom
Other DBs
NCBI-GeneID: 232413
NCBI-ProteinID: NP_808354
MGI: 3040968
Ensembl: ENSMUSG00000053063
Vega: OTTMUSG00000026999
UniProt: Q504P2 A0A0R4J0T2
Position
6; 6 F3
AA seq 267 aa
MSEEIVYANLKIQDPDKKEETQKSDKCGGKVSADASHSQQKTVLILILLCLLLFIGMGVL
GGIFYTTLATEMIKSNQLQRAKEELQENVSLQLKHNLNSSKKIKNLSAMLQSTATQLCRE
LYSKEPEHKCKPCPKGSEWYKDSCYSQLNQYGTWQESVMACSARNASLLKVKNKDVLEFI
KYKKLRYFWLALLPRKDRTQYPLSEKMFLSEESERSTDDIDKKYCGYIDRVNVYYTYCTD
ENNIICEETASKVQLESVLNGLPEDSR
NT seq 804 nt   +upstreamnt  +downstreamnt
atgtctgaagaaattgtttatgcaaatctcaaaatccaggaccctgataaaaaagaagaa
acccagaagtctgacaaatgtgggggaaaagtatccgccgatgcttcccattcacagcaa
aaaacagtcttgattctgattcttctatgccttctgctgttcattggaatgggggtctta
ggaggcatcttttatacaactttggcaacagaaatgataaaatcgaatcaattgcaaagg
gccaaggaagaacttcaggaaaatgtttccctacagctgaagcacaatctcaacagctcc
aagaaaatcaagaacctttctgccatgctgcaaagcacagccacccagctgtgccgagag
ctgtatagcaaagaaccagagcacaaatgtaaaccatgtccaaagggttcagaatggtac
aaggacagctgttattctcaactcaatcagtatggaacatggcaagagagtgtcatggcc
tgctctgctcggaatgccagcctcctgaaggttaagaacaaggatgtgctggaatttata
aagtacaagaagctacgctatttttggcttgcattgttgcccagaaaagatcgcacacaa
tatccactaagtgagaagatgttcctctctgaagagtctgaaagaagcacagatgacata
gataagaagtactgcggatatatagacagggtcaatgtttattatacatactgcactgat
gagaacaatatcatatgtgaagagacagccagcaaggtgcagttggaaagtgtgttgaat
ggcctcccagaggatagcaggtag

DBGET integrated database retrieval system