KEGG   Mus musculus (mouse): 232440
Entry
232440            CDS       T01002                                 

Gene name
H2aj, E130307C13, H2afj
Definition
(RefSeq) H2J.A histone
  KO
K11251  histone H2A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    232440 (H2aj)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    232440 (H2aj)
  09165 Substance dependence
   05034 Alcoholism
    232440 (H2aj)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    232440 (H2aj)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    232440 (H2aj)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    232440 (H2aj)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   232440 (H2aj)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 232440
NCBI-ProteinID: NP_808356
MGI: 3606192
Ensembl: ENSMUSG00000060032
Vega: OTTMUSG00000022214
UniProt: Q8R1M2
Position
6; 6 G1
AA seq 129 aa
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESQKVKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtccgggcgaggcaagcagggcggtaaggtgcgcgccaaggccaagtcgcgctcgtcg
cgcgcgggcctgcagttccccgtgggccgcgttcaccggctgctgcggaagggcaactac
gcggagcgcgtgggcgcgggagcgcccgtgtacctggcggcggtgctggagtacctgacg
gccgagatcctggagctggcgggcaacgcggcgagggacaacaagaagacgcgcatcatc
cctcgtcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgt
gtgaccatcgcgcagggcggcgtcctgcccaatatccaggccgtgctgctgcccaagaag
acggagagccagaaggtgaagagcaagtga

DBGET integrated database retrieval system