KEGG   Mus musculus (house mouse): 232449
Entry
232449            CDS       T01002                                 
Symbol
Dera, 2010002D22Rik, 2500002K03Rik, DEOC
Name
(RefSeq) deoxyribose-phosphate aldolase (putative)
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00030  Pentose phosphate pathway
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    232449 (Dera)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     232449 (Dera)
SSDB
Motif
Pfam: DeoC DUF5744
Other DBs
NCBI-GeneID: 232449
NCBI-ProteinID: NP_766321
MGI: 1913762
Ensembl: ENSMUSG00000030225
UniProt: Q91YP3
Position
6:137731093..137814894
AA seq 318 aa
MAAHCRGTELDLSWISKVQVNHAAVLRRAQQIQARRSVKKEWQAAWLLKAVTFIDLTTLS
GDDTFSNVQRLCYKAKYPIRADLLKALNMDDKGITTAAVCVYPARVCDAVKALKAAGCSI
PVASVATGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRTLVLTGQWEALYDEVTQFRK
ACGEAHLKTILATGELGSLTNVYKASLVAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKVGFKPAGGIRTAKESLAWLSLVKEELGDEWLTPDLFRIGASSLLSDIERQ
IYHHVTGRYAAYHDLPMS
NT seq 957 nt   +upstreamnt  +downstreamnt
atggctgctcactgccggggcacagagctcgatcttagctggatctccaaagttcaagtg
aatcacgcggctgtgctgaggcgggcccagcagatccaggctcgcagaagcgtgaagaag
gaatggcaggctgcgtggctcctgaaagctgtcacgtttatagatcttaccacgctttct
ggcgatgacacgttttccaacgttcaacgactctgttataaagccaaatatccaatccgg
gcagacctcttaaaagctttaaatatggatgacaaaggcatcaccacagctgcagtctgc
gtttatcccgcccgggtgtgcgacgctgtgaaggcgctgaaggctgcgggctgcagcatc
cccgtggcctcagtggccactggctttccagctggacagactcatttaaagactcgattg
gaagagatcagactggccgtggaggatggagctactgaaattgacgtggtcattaacagg
accttggtgctgacgggccagtgggaagctctctacgatgaggtcactcagtttcgaaag
gcctgtggcgaggcccatctcaaaaccatcctagctacgggcgaactgggctctctcacc
aacgtctacaaagccagcctggtagcgatgatggcaggatcagattttattaagacctct
actggaaaggaaacagtaaacgccaccttcccagtcgccatcgtgatgctgcgggccatt
agagatttcttctggaaaactggaaacaaggtgggcttcaagcctgccggaggcatccgc
actgcaaaggagtccctggcgtggctctccctggtcaaggaggaactaggagatgagtgg
ctgacgcctgacctcttccggataggggccagttctctgctctcagacatcgagagacag
atttaccatcacgtgactggacgctacgcggcttatcatgatcttccgatgtcttag

DBGET integrated database retrieval system